StarFunc result for job id Q569H4

User Input

>input (304 residues)
MSAKSKGNPSSSCPAEGPPAASKTKVKEQIKIIVEDLELVLGDLKDVAKELKEVVDQIDT
LTSDLQLEDEMTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKP
NPPPPPPRLTPVKCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLD
KAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHP
PGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRPATVPPPTAPKPQKTILRKST
TTTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KMN5	0.795	0.795	8.199E-38	304	0.928	0.928	A3KMN5.pdb.gz	LARGN_MOUSE Protein Largen OS=Mus musculus OX=10090 GN=Prr16 PE=2 SV=1
2	AFDB:Q8CD60	0.223	0.231	2.190E-5	292	0.276	0.288	Q8CD60.pdb.gz	INSY1_MOUSE Inhibitory synaptic factor 1 OS=Mus musculus OX=10090 GN=Insyn1 PE=1 SV=1
3	AFDB:P54785	0.149	0.096	5.082E-2	490	0.138	0.086	P54785.pdb.gz	MOT3_YEAST Transcriptional activator/repressor MOT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT3 PE=1 SV=1
4	AFDB:A0A2R8QH31	0.100	0.068	1.220E-1	493	0.194	0.120	A0A2R8QH31.pdb.gz
5	AFDB:Q9U1W1	0.110	0.073	5.750E-1	486	0.191	0.119	Q9U1W1.pdb.gz	TFG_CAEEL Protein tfg-1 OS=Caenorhabditis elegans OX=6239 GN=tfg-1 PE=1 SV=1
6	AFDB:Q8MQJ7	0.098	0.049	6.151E-1	855	0.145	0.051	Q8MQJ7.pdb.gz	Q8MQJ7_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=1 SV=1
7	AFDB:Q9Y6I3	0.136	0.083	6.579E-1	576	0.204	0.108	Q9Y6I3.pdb.gz	EPN1_HUMAN Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2
8	AFDB:Q9PUQ1	0.135	0.092	7.529E-1	494	0.171	0.105	Q9PUQ1.pdb.gz	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
9	AFDB:O94421	0.097	0.030	8.615E-1	1680	0.158	0.029	O94421.pdb.gz	SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf22 PE=1 SV=2
10	AFDB:A0A2R8QCI3	0.140	0.025	1.128	2023	0.181	0.027	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q569H4	0.0	607	304	1.000	1.000	LARGN_HUMAN Protein Largen OS=Homo sapiens OX=9606 GN=PRR16 PE=1 SV=1
2	A3KMN5	1.35e-173	484	304	0.928	0.928	LARGN_MOUSE Protein Largen OS=Mus musculus OX=10090 GN=Prr16 PE=2 SV=1
3	Q8CD60	1.83e-14	74.3	292	0.299	0.312	INSY1_MOUSE Inhibitory synaptic factor 1 OS=Mus musculus OX=10090 GN=Insyn1 PE=1 SV=1
4	Q2T9L4	1.35e-13	72.0	293	0.234	0.242	INSY1_HUMAN Inhibitory synaptic factor 1 OS=Homo sapiens OX=9606 GN=INSYN1 PE=1 SV=1
5	O95789	0.18	36.2	1325	0.102	0.023	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
6	Q8I3F9	0.80	33.9	2675	0.082	0.009	Q8I3F9_PLAF7 Formin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0530900 PE=4 SV=1
7	Q9WUU8	1.8	32.7	647	0.082	0.039	TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus musculus OX=10090 GN=Tnip1 PE=1 SV=1
8	Q6EBV9	3.8	32.0	922	0.062	0.021	ATG9B_MOUSE Autophagy-related protein 9B OS=Mus musculus OX=10090 GN=Atg9b PE=2 SV=2
9	P40352	6.2	31.2	1085	0.046	0.013	RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1
10	O49675	6.4	30.8	595	0.086	0.044	CCD4_ARATH Probable carotenoid cleavage dioxygenase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCD4 PE=1 SV=1
11	Q9AUJ7	9.2	30.4	527	0.069	0.040	IF4B1_WHEAT Eukaryotic translation initiation factor 4B1 OS=Triticum aestivum OX=4565 GN=EIF4B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18718 CxC5	2.9e+02	13.0	CxC5 like cysteine cluster associated with KDZ transposases
2	PF15252 DUF4589	6.5e-67	237.6	Domain of unknown function (DUF4589)
3	PF19148 DUF5830	7.2e+02	11.5	Family of unknown function (DUF5830)
4	PF13717 zinc_ribbon_4	4.7e+02	12.1	zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394510	0.798	Proline-rich protein 12
2	9606.ENSP00000430497	0.738	Zinc finger homeobox protein 4
3	9606.ENSP00000324920	0.605	Protein SIX6OS1
4	9606.ENSP00000373298	0.577	Acetylcholinesterase collagenic tail peptide
5	9606.ENSP00000389814	0.563	Adiponectin
6	9606.ENSP00000367164	0.556	Proline rich 20A
7	9606.ENSP00000438757	0.556	Proline-rich protein 20A
8	9606.ENSP00000392407	0.543	Proline rich 20D
9	9606.ENSP00000216139	0.534	Acrosin
10	9606.ENSP00000378710	0.510	Protein FAM135B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.994	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.969	positive regulation of biological process
GO:0019222	0.966	regulation of metabolic process
GO:0009893	0.961	positive regulation of metabolic process
GO:0031326	0.961	regulation of cellular biosynthetic process
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0016043	0.953	cellular component organization
GO:0008361	0.938	regulation of cell size
GO:0010556	0.933	regulation of macromolecule biosynthetic process
GO:0045793	0.931	positive regulation of cell size
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0031325	0.872	positive regulation of cellular metabolic process
GO:0080090	0.862	regulation of primary metabolic process
GO:0051173	0.764	positive regulation of nitrogen compound metabolic process
GO:0010604	0.715	positive regulation of macromolecule metabolic process
GO:0010557	0.710	positive regulation of macromolecule biosynthetic process
GO:0031328	0.706	positive regulation of cellular biosynthetic process
GO:0010468	0.702	regulation of gene expression
GO:2000112	0.660	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.626	regulation of amide metabolic process
GO:0051246	0.539	regulation of protein metabolic process
GO:0051247	0.511	positive regulation of protein metabolic process
GO:0010628	0.466	positive regulation of gene expression
GO:0034250	0.392	positive regulation of amide metabolic process
GO:0045727	0.370	positive regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043226	0.988	organelle
GO:0030054	0.978	cell junction
GO:0005622	0.917	intracellular anatomical structure
GO:0043229	0.844	intracellular organelle
GO:0005634	0.832	nucleus
GO:0005737	0.693	cytoplasm
GO:0043233	0.478	organelle lumen
GO:0070013	0.448	intracellular organelle lumen
GO:0045202	0.361	synapse
GO:0031981	0.351	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]