StarFunc result for job id Q56P03

User Input

>input (285 residues)
MNRLPDDYDPYAVEEPSDEEPALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSSEDE
FEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQV
TKKKKKKQHKIPTNDELLYDPEKDNRDQAWVDAQRRGYHGLGPQRSRQQQPVPNSDAVLN
CPACMTTLCLDCQRHESYKTQYRAMFVMNCSINKEEVLRYKASENRKKRRVHKKMRSNRE
DAAEKAETDVEEIYHPVMCTECSTEVAVYDKDEVFHFFNVLASHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q56P03	1.000	1.000	2.663E-51	285	1.000	1.000	Q56P03.pdb.gz	EAPP_HUMAN E2F-associated phosphoprotein OS=Homo sapiens OX=9606 GN=EAPP PE=1 SV=4
2	PDB:6h0gB	0.201	0.146	6.823E-2	401	0.046	0.032	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
3	AFDB:Q0DC89	0.210	0.271	1.112E-1	214	0.081	0.107	Q0DC89.pdb.gz	MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MSRB1 PE=1 SV=2
4	PDB:5fqdE	0.193	0.152	1.548E-1	367	0.039	0.030	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
5	PDB:6symA	0.118	0.234	2.780E-1	135	0.042	0.089	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
6	PDB:6yugA	0.066	0.108	4.188E-1	143	0.049	0.098	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
7	PDB:5apno	0.130	0.246	4.440E-1	105	0.053	0.143	5apno.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
8	AFDB:Q9C5C8	0.170	0.232	4.806E-1	202	0.074	0.104	Q9C5C8.pdb.gz	MSRB2_ARATH Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSRB2 PE=1 SV=1
9	AFDB:Q4G079	0.123	0.114	1.378	315	0.095	0.086	Q4G079.pdb.gz	Q4G079_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
10	AFDB:Q5PSV4	0.096	0.086	1.549	323	0.126	0.111	Q5PSV4.pdb.gz	BRM1L_HUMAN Breast cancer metastasis-suppressor 1-like protein OS=Homo sapiens OX=9606 GN=BRMS1L PE=1 SV=2
11	PDB:6h61A	0.078	0.045	1.609	660	0.053	0.023	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
12	PDB:6hlqI	0.066	0.130	1.809	111	0.060	0.153	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
13	AFDB:P03881	0.108	0.074	1.958	472	0.063	0.038	P03881.pdb.gz	YMRF1_YEAST Uncharacterized mitochondrial protein RF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=Q0255 PE=4 SV=3
14	AFDB:P38880	0.115	0.067	2.076	579	0.084	0.041	P38880.pdb.gz	MDM31_YEAST Mitochondrial distribution and morphology protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM31 PE=1 SV=1
15	AFDB:B1AVY7	0.098	0.035	2.334	1312	0.119	0.026	B1AVY7.pdb.gz	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
16	PDB:1ct9A	0.071	0.049	2.425	497	0.032	0.018	1ct9A.pdb.gz	Three-dimensional structure of Escherichia coli asparagine synthetase B: a short journey from substrate to product.
17	PDB:4v6wCo	0.098	0.198	2.425	104	0.056	0.154	4v6wCo.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:6lss4	0.108	0.057	2.571	620	0.109	0.050	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
19	AFDB:A0A0P0VNG4	0.114	0.092	2.624	373	0.144	0.110	A0A0P0VNG4.pdb.gz	A0A0P0VNG4_ORYSJ Os02g0691500 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0691500 PE=3 SV=1
20	AFDB:O88512	0.106	0.050	2.624	791	0.112	0.040	O88512.pdb.gz	AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus OX=10090 GN=Ap1g2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q56P03	0.0	595	285	1.000	1.000	EAPP_HUMAN E2F-associated phosphoprotein OS=Homo sapiens OX=9606 GN=EAPP PE=1 SV=4
2	P39900	1.6	32.7	470	0.088	0.053	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
3	Q9C0D2	2.1	32.7	2601	0.102	0.011	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
4	P33751	2.4	31.6	242	0.067	0.079	PAD1_YEAST Flavin prenyltransferase PAD1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAD1 PE=1 SV=2
5	B5MEB3	4.2	31.6	590	0.095	0.046	B5MEB3_HUMAN Calcineurin binding protein 1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
6	A0A087WWW8	4.6	31.6	2170	0.095	0.012	A0A087WWW8_HUMAN Calcineurin binding protein 1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
7	Q9Y6J0	4.9	31.2	2220	0.095	0.012	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
8	P0CG38	6.2	30.8	1075	0.123	0.033	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
9	P0CG39	6.4	30.8	1038	0.123	0.034	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
10	A5A3E0	7.2	30.8	1075	0.123	0.033	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	1.3e+02	14.3	TFIIH C1-like domain
2	PF10238 Eapp_C	4.3e-48	174.7	E2F-associated phosphoprotein
3	PF01485 IBR	1.3e+02	14.1	IBR domain, a half RING-finger domain
4	PF08171 Mad3_BUB1_II	3.3e+02	12.9	Mad3/BUB1 homology region 2
5	PF04360 Serglycin	56	15.1	Serglycin
6	PF03226 Yippee-Mis18	5.1e+02	12.3	Yippee zinc-binding/DNA-binding /Mis18, centromere assembly

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363043	0.935	Protein AAR2 homolog
2	9606.ENSP00000317123	0.906	U5 small nuclear ribonucleoprotein 200 kDa helicase
3	9606.ENSP00000460348	0.875	Pre-mRNA-processing-splicing factor 8
4	9606.ENSP00000331087	0.853	Protein TSSC4
5	9606.ENSP00000310723	0.818	Probable ATP-dependent RNA helicase DDX23
6	9606.ENSP00000392094	0.804	116 kDa U5 small nuclear ribonucleoprotein component
7	9606.ENSP00000170564	0.764	G-patch domain containing 1
8	9606.ENSP00000303468	0.762	Zinc finger CCHC domain-containing protein 4
9	9606.ENSP00000252011	0.753	Probable ATP-dependent RNA helicase DHX35
10	9606.ENSP00000401566	0.751	Protein ecdysoneless homolog
11	9606.ENSP00000304903	0.747	CD2 antigen cytoplasmic tail-binding protein 2
12	9606.ENSP00000225729	0.743	Developmentally-regulated GTP-binding protein 2
13	9606.ENSP00000264779	0.735	Vasculin
14	9606.ENSP00000300452	0.699	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
15	9606.ENSP00000426613	0.699	TNFAIP3-interacting protein 3
16	9606.ENSP00000418001	0.697	Glycerol kinase 5
17	9606.ENSP00000470560	0.695	Ribosomal RNA small subunit methyltransferase NEP1
18	9606.ENSP00000273064	0.692	CCR4-NOT transcription complex subunit 9
19	9606.ENSP00000400591	0.691	Small nuclear ribonucleoprotein E
20	9606.ENSP00000219281	0.686	U6 snRNA phosphodiesterase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.646	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010557	0.980	positive regulation of macromolecule biosynthetic process
GO:0031328	0.980	positive regulation of cellular biosynthetic process
GO:0051173	0.977	positive regulation of nitrogen compound metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0048519	0.966	negative regulation of biological process
GO:0045893	0.945	positive regulation of DNA-templated transcription
GO:0006357	0.942	regulation of transcription by RNA polymerase II
GO:0048523	0.935	negative regulation of cellular process
GO:0051172	0.933	negative regulation of nitrogen compound metabolic process
GO:0045892	0.902	negative regulation of DNA-templated transcription
GO:0034243	0.885	regulation of transcription elongation by RNA polymerase II
GO:0045944	0.855	positive regulation of transcription by RNA polymerase II
GO:0042127	0.774	regulation of cell population proliferation
GO:0032968	0.745	positive regulation of transcription elongation by RNA polymerase II
GO:0009987	0.660	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.941	protein-containing complex
GO:0005737	0.819	cytoplasm
GO:0031981	0.782	nuclear lumen
GO:0005654	0.398	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]