StarFunc result for job id Q56P42

User Input

>input (97 residues)
MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFT
SHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q56P42	1.000	1.000	6.861E-14	97	1.000	1.000	Q56P42.pdb.gz	PYDC2_HUMAN Pyrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PYDC2 PE=1 SV=1
2	AFDB:Q9NX02	0.827	0.083	3.367E-7	1062	0.629	0.057	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
3	AFDB:Q8WX94	0.836	0.093	1.632E-4	980	0.392	0.039	Q8WX94.pdb.gz	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
4	AFDB:E9Q5R7	0.781	0.082	5.448E-4	1054	0.216	0.020	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
5	AFDB:F1MT67	0.803	0.075	9.200E-4	1098	0.237	0.021	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
6	AFDB:P59046	0.804	0.084	9.200E-4	1061	0.268	0.025	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
7	AFDB:F8W6Z2	0.804	0.140	2.242E-3	601	0.206	0.033	F8W6Z2.pdb.gz	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
8	AFDB:Q9JJ25	0.811	0.118	3.990E-3	750	0.237	0.031	Q9JJ25.pdb.gz	MEFV_RAT Pyrin OS=Rattus norvegicus OX=10116 GN=Mefv PE=2 SV=2
9	PDB:7pzcA	0.769	0.085	4.250E-3	1010	0.237	0.023	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
10	AFDB:P59047	0.794	0.073	5.186E-3	1200	0.268	0.022	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
11	AFDB:Q66X22	0.746	0.080	5.465E-3	1003	0.237	0.023	Q66X22.pdb.gz	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
12	PDB:5h7nB	0.750	0.177	1.036E-2	460	0.247	0.052	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
13	PDB:2hm2Q	0.776	0.839	2.047E-2	89	0.165	0.180	2hm2Q.pdb.gz
14	PDB:2kn6A	0.768	0.404	3.281E-2	195	0.165	0.082	2kn6A.pdb.gz
15	PDB:6p6cA	0.612	0.649	7.201E-2	90	0.155	0.167	6p6cA.pdb.gz
16	PDB:6ndjB	0.547	0.140	2.669E-1	443	0.186	0.041	6ndjB.pdb.gz
17	PDB:7r5vN	0.433	0.173	1.098	297	0.103	0.034	7r5vN.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
18	PDB:5vmmD	0.285	0.248	1.355	128	0.186	0.141	5vmmD.pdb.gz	Structure-function analyses reveal key features in Staphylococcus aureus IsdB-associated unfolding of the heme-binding pocket of human hemoglobin.
19	PDB:3rgkA	0.262	0.194	2.541	149	0.134	0.087	3rgkA.pdb.gz	X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution
20	PDB:3kloA	0.252	0.130	2.677	217	0.124	0.055	3kloA.pdb.gz	Vibrio cholerae VpsT Regulates Matrix Production and Motility by Directly Sensing Cyclic di-GMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q56P42	3.33e-69	203	97	1.000	1.000	PYDC2_HUMAN Pyrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PYDC2 PE=1 SV=1
2	J3KN39	7.50e-33	121	1059	0.629	0.058	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
3	Q9NX02	7.57e-33	121	1062	0.629	0.057	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
4	P0DMW2	9.01e-19	74.3	45	0.371	0.800	PYDC4_HUMAN NLR family pyrin domain-containing protein 2B OS=Homo sapiens OX=9606 GN=NLRP2B PE=2 SV=1
5	Q8WX94	3.29e-15	71.2	980	0.381	0.038	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
6	Q96MN2	7.96e-09	53.1	994	0.299	0.029	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
7	F1MT67	5.43e-05	42.4	1098	0.227	0.020	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
8	Q647I9	5.54e-05	42.4	1098	0.227	0.020	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
9	Q7RTR0	1.10e-04	41.6	991	0.268	0.026	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
10	P59047	1.40e-04	41.2	1200	0.247	0.020	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
11	Q86W24	3.02e-04	40.0	1093	0.268	0.024	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
12	Q3UWL9	0.008	36.2	944	0.258	0.026	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
13	Q66JP4	0.008	36.2	738	0.247	0.033	Q66JP4_MOUSE NLR family, pyrin domain containing 4G OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
14	F8W6Z2	0.027	34.7	601	0.186	0.030	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
15	O15553	0.041	34.3	781	0.186	0.023	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
16	Q66X22	0.12	32.7	1003	0.247	0.024	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
17	E9Q5R7	0.23	32.0	1054	0.206	0.019	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
18	Q4U4S6	0.30	31.6	3784	0.186	0.005	XIRP2_MOUSE Xin actin-binding repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Xirp2 PE=1 SV=1
19	P59046	0.32	31.6	1061	0.237	0.022	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
20	Q66X05	0.33	31.6	959	0.258	0.026	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02758 PYRIN	5.7e-16	69.7	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247470	0.917	Apoptosis-associated speck-like protein containing a CARD
2	9606.ENSP00000219596	0.616	Pyrin
3	9606.ENSP00000304336	0.608	Pyrin domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.396	identical protein binding
GO:0003824	0.364	catalytic activity
GO:1901363	0.339	heterocyclic compound binding
GO:0097159	0.339	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010803	0.994	regulation of tumor necrosis factor-mediated signaling pathway
GO:0032088	0.994	negative regulation of NF-kappaB transcription factor activity
GO:0032651	0.992	regulation of interleukin-1 beta production
GO:0050727	0.991	regulation of inflammatory response
GO:0001960	0.988	negative regulation of cytokine-mediated signaling pathway
GO:0032692	0.985	negative regulation of interleukin-1 production
GO:1902531	0.978	regulation of intracellular signal transduction
GO:0051128	0.976	regulation of cellular component organization
GO:0050728	0.945	negative regulation of inflammatory response
GO:1902532	0.943	negative regulation of intracellular signal transduction
GO:0044087	0.927	regulation of cellular component biogenesis
GO:1901222	0.910	regulation of NIK/NF-kappaB signaling
GO:0043254	0.890	regulation of protein-containing complex assembly
GO:0031333	0.837	negative regulation of protein-containing complex assembly
GO:0048518	0.825	positive regulation of biological process
GO:0051246	0.773	regulation of protein metabolic process
GO:0010604	0.718	positive regulation of macromolecule metabolic process
GO:0050896	0.595	response to stimulus
GO:0050790	0.509	regulation of catalytic activity
GO:0030162	0.490	regulation of proteolysis
GO:0009987	0.411	cellular process
GO:0052547	0.375	regulation of peptidase activity
GO:0052548	0.338	regulation of endopeptidase activity
GO:1901223	0.334	negative regulation of NIK/NF-kappaB signaling
GO:0051248	0.320	negative regulation of protein metabolic process
GO:0032691	0.319	negative regulation of interleukin-1 beta production
GO:0032731	0.313	positive regulation of interleukin-1 beta production
GO:2000116	0.312	regulation of cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.938	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]