StarFunc result for job id Q56UN5

User Input

>input (1328 residues)
MSSMPKPERHAESLLDICHDTNSSPTDLMTVTKNQNIILQSISRSEEFDQDGDCSHSTLV
NEEEDPSGGRQDWQPRTEGVEITVTFPRDVSPPQEMSQEDLKEKNLINSSLQEWAQAHAV
SHPNEIETVELRKKKLTMRPLVLQKEESSRELCNVNLGFLLPRSCLELNISKSVTREDAP
HFLKEQQRKSEEFSTSHMKYSGRSIKFLLPPLSLLPTRSGVLTIPQNHKFPKEKERNIPS
LTSFVPKLSVSVRQSDELSPSNEPPGALVKSLMDPTLRSSDGFIWSRNMCSFPKTNHHRQ
CLEKEENWKSKEIEECNKIEITHFEKGQSLVSFENLKEGNIPAVREEDIDCHGSKTRKPE
EENSQYLSSRKNESSVAKNYEQDPEIVCTIPSKFQETQHSEITPSQDEEMRNNKAASKRV
SLHKNEAMEPNNILEECTVLKSLSSVVFDDPIDKLPEGCSSMETNIKISIAERAKPEMSR
MVPLIHITFPVDGSPKEPVIAKPSLQTRKGTIHNNHSVNIPVHQENDKHKMNSHRSKLDS
KTKTSKKTPQNFVISTEGPIKPTMHKTSIKTQIFPALGLVDPRPWQLPRFQKKMPQIAKK
QSTHRTQKPKKQSFPCICKNPGTQKSCVPLSVQPTEPRLNYLDLKYSDMFKEINSTANGP
GIYEMFGTPVYCHVRETERDENTYYREICSAPSGRRITNKCRSSHSERKSNIRTRLSQKK
THMKCPKTSFGIKQEHKVLISKEKSSKAVHSNLHDIENGDGISEPDWQIKSSGNEFLSSK
DEIHPMNLAQTPEQSMKQNEFPPVSDLSIVEEVSMEESTGDRDISNNQILTTSLRDLQEL
EELHHQIPFIPSEDSWAVPSEKNSNKYVQQEKQNTASLSKVNASRILTNDLEFDSVSDHS
KTLTNFSFQAKQESASSQTYQYWVHYLDHDSLANKSITYQMFGKTLSGTNSISQEIMDSV
NNEELTDELLGCLAAELLALDEKDNNSCQKMANETDPENLNLVLRWRGSTPKEMGRETTK
VKIQRHSSGLRIYDREEKFLISNEKKIFSENSLKSEEPILWTKGEILGKGAYGTVYCGLT
SQGQLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFM
EFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGII
KLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEM
ATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQLLK
HSFLERSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CY24	0.189	0.203	7.445E-23	1228	0.176	0.191	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
2	PDB:5ufuA	0.183	0.634	3.129E-19	369	0.053	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
3	PDB:4eomC	0.178	0.800	3.690E-19	276	0.059	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
4	PDB:4krcA	0.180	0.748	4.351E-19	297	0.069	0.306	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
5	PDB:4yc3A	0.172	0.721	6.050E-19	295	0.060	0.271	4yc3A.pdb.gz
6	PDB:5u6yA	0.183	0.508	1.048E-18	459	0.059	0.170	5u6yA.pdb.gz
7	PDB:4zhxA	0.187	0.584	1.170E-18	409	0.053	0.174	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
8	PDB:2yaaA	0.181	0.759	2.262E-18	300	0.056	0.250	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
9	PDB:4c0tA	0.179	0.775	2.390E-18	291	0.049	0.223	4c0tA.pdb.gz
10	PDB:7myjC	0.184	0.507	3.323E-18	465	0.053	0.153	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
11	PDB:6b1uA	0.185	0.540	3.511E-18	442	0.053	0.158	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
12	AFDB:P18161	0.180	0.206	5.202E-18	1155	0.142	0.164	P18161.pdb.gz	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2
13	AFDB:Q09690	0.173	0.209	6.166E-17	1087	0.131	0.160	Q09690.pdb.gz	POM1_SCHPO DYRK-family kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pom1 PE=1 SV=1
14	AFDB:F4HQ88	0.177	0.200	1.658E-16	1169	0.156	0.177	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
15	AFDB:Q8IDK6	0.177	0.132	1.578E-15	1807	0.175	0.128	Q8IDK6.pdb.gz	Q8IDK6_PLAF7 Tyrosine kinase-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1349300 PE=4 SV=1
16	AFDB:B7Z126	0.187	0.167	1.870E-14	1489	0.142	0.127	B7Z126.pdb.gz	B7Z126_DROME Tousled-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
17	AFDB:Q8INJ8	0.186	0.232	2.747E-14	1052	0.133	0.167	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
18	AFDB:Q9NYV4	0.177	0.159	3.423E-14	1490	0.138	0.123	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
19	AFDB:Q14004	0.181	0.161	1.146E-13	1512	0.149	0.131	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
20	AFDB:G5EB22	0.162	0.203	4.528E-13	1050	0.136	0.172	G5EB22.pdb.gz	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O22040	8.42e-78	273	666	0.102	0.203	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
2	Q9FZ36	4.21e-77	271	651	0.102	0.209	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
3	Q54R82	5.52e-77	277	942	0.097	0.137	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
4	Q40541	7.12e-77	271	690	0.099	0.191	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
5	O22042	3.46e-73	259	651	0.101	0.206	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
6	Q99759	2.62e-70	251	626	0.101	0.214	M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2
7	X1WGZ3	9.06e-70	249	620	0.096	0.206	X1WGZ3_DANRE Mitogen-activated protein kinase kinase kinase 3 OS=Danio rerio OX=7955 GN=map3k3 PE=4 SV=1
8	Q61084	1.76e-69	248	626	0.100	0.212	M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1
9	Q9Y2U5	1.37e-68	245	619	0.101	0.216	M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2
10	F1M9D0	3.57e-68	244	619	0.101	0.216	F1M9D0_RAT Mitogen activated protein kinase kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map3k2 PE=1 SV=2
11	F4HRJ4	4.95e-68	243	609	0.091	0.199	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
12	Q61083	1.72e-67	242	619	0.101	0.216	M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2
13	Q6FXI1	1.99e-63	231	676	0.102	0.201	Q6FXI1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE11 PE=3 SV=1
14	Q9CAD5	3.40e-62	232	883	0.088	0.133	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
15	A0A078CGE6	5.36e-62	235	1299	0.090	0.092	M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus OX=3708 GN=M3KE1 PE=1 SV=1
16	Q9SFB6	6.27e-62	235	1367	0.088	0.086	M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MAP3KE2 PE=2 SV=1
17	Q9LJD8	8.81e-62	234	1368	0.090	0.087	M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=M3KE1 PE=1 SV=1
18	Q389U2	1.18e-60	222	606	0.095	0.208	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1
19	G5EB26	2.62e-59	223	886	0.084	0.125	G5EB26_EMENI MAPKK kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02269 PE=3 SV=1
20	Q39008	2.67e-59	218	608	0.085	0.186	M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana OX=3702 GN=MEKK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	4.5	18.6	Phosphotransferase enzyme family
2	PF14531 Kinase-like	0.0098	26.8	Kinase-like
3	PF00069 Pkinase	3.2e-64	228.5	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1.5e-44	163.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365005

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301037	0.736	Uncharacterized serine/threonine-protein kinase SgK494
2	9606.ENSP00000323549	0.630	Sodium-dependent neutral amino acid transporter B(0)AT3
3	9606.ENSP00000250615	0.604	Serotonin N-acetyltransferase
4	9606.ENSP00000454770	0.599	Ankyrin repeat domain-containing protein 66
5	9606.ENSP00000379174	0.590	DNA-directed DNA/RNA polymerase mu
6	9606.ENSP00000445786	0.541	Protein FAM216B
7	9606.ENSP00000370639	0.539	Acetylserotonin O-methyltransferase
8	9606.ENSP00000469863	0.536	Dual specificity tyrosine-phosphorylation-regulated kinase 1B
9	9606.ENSP00000427661	0.534	Anion exchange protein 4
10	9606.ENSP00000336661	0.521	Leucine-rich repeat-containing protein 71
11	9606.ENSP00000387907	0.512	Protein ANKUB1
12	9606.ENSP00000433427	0.509	ADP-ribosylation factor-like protein 15
13	9606.ENSP00000282670	0.506	Tctex1 domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	0.996	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071840	0.732	cellular component organization or biogenesis
GO:0016043	0.719	cellular component organization
GO:0051128	0.570	regulation of cellular component organization
GO:0048518	0.556	positive regulation of biological process
GO:0050896	0.482	response to stimulus
GO:0048522	0.465	positive regulation of cellular process
GO:0008152	0.441	metabolic process
GO:0044237	0.413	cellular metabolic process
GO:0071704	0.389	organic substance metabolic process
GO:0044238	0.359	primary metabolic process
GO:0006807	0.334	nitrogen compound metabolic process
GO:0043170	0.311	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0005634	0.967	nucleus
GO:0005829	0.941	cytosol
GO:0043232	0.907	intracellular non-membrane-bounded organelle
GO:0032991	0.654	protein-containing complex
GO:0031981	0.486	nuclear lumen
GO:0005654	0.409	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]