StarFunc result for job id Q56UQ5

User Input

>input (140 residues)
METVIMITYWDLISHSEMFSDSYMSQEIADGLRLEVEGKIVSRTEGNIFDSLIGGNASAE
GPEGKGTESTVITGVDSVMNHHLQETSFTKEAYNKCIKDYMKSIKGKLEEQRPKRVKPFM
TGAAEQIKHILANFKNYQKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J2C3	0.830	0.603	2.297E-16	197	0.814	0.579	A0A0B4J2C3.pdb.gz	A0A0B4J2C3_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
2	PDB:2hr9A	0.696	0.570	2.037E-14	174	0.807	0.649	2hr9A.pdb.gz
3	PDB:5o9lA	0.744	0.658	3.500E-12	159	0.671	0.591	5o9lA.pdb.gz
4	AFDB:Q7ZYF2	0.790	0.653	2.492E-11	172	0.514	0.419	Q7ZYF2.pdb.gz	TCTP_XENLA Translationally-controlled tumor protein homolog OS=Xenopus laevis OX=8355 GN=tpt1 PE=1 SV=1
5	AFDB:Q9VGS2	0.688	0.568	5.787E-8	172	0.379	0.308	Q9VGS2.pdb.gz	TCTP_DROME Translationally-controlled tumor protein homolog OS=Drosophila melanogaster OX=7227 GN=Tctp PE=1 SV=1
6	AFDB:Q54RX6	0.768	0.633	1.218E-7	174	0.314	0.253	Q54RX6.pdb.gz	TCTP1_DICDI Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282853 PE=3 SV=1
7	PDB:1h6qA	0.692	0.587	6.634E-7	168	0.364	0.304	1h6qA.pdb.gz
8	AFDB:Q8I3Z5	0.637	0.530	1.983E-6	171	0.314	0.257	Q8I3Z5.pdb.gz	TCTP_PLAF7 Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TCTP PE=1 SV=1
9	AFDB:P35691	0.692	0.589	2.245E-6	167	0.307	0.257	P35691.pdb.gz	TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMA19 PE=1 SV=1
10	AFDB:P31265	0.686	0.584	3.686E-6	168	0.293	0.244	P31265.pdb.gz	TCTP1_ARATH Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana OX=3702 GN=TCTP1 PE=1 SV=2
11	AFDB:Q10344	0.697	0.586	4.440E-6	168	0.357	0.298	Q10344.pdb.gz	TCTP_SCHPO Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=p23fy PE=1 SV=1
12	AFDB:Q5A860	0.683	0.581	8.253E-6	167	0.329	0.275	Q5A860.pdb.gz	TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TMA19 PE=3 SV=1
13	AFDB:Q93573	0.691	0.542	1.058E-5	181	0.293	0.227	Q93573.pdb.gz	TCTP_CAEEL Translationally-controlled tumor protein homolog OS=Caenorhabditis elegans OX=6239 GN=tct-1 PE=1 SV=1
14	PDB:3p3kA	0.604	0.536	3.733E-5	159	0.271	0.239	3p3kA.pdb.gz
15	PDB:6dhtA	0.136	0.038	7.076	547	0.050	0.013	6dhtA.pdb.gz	A Cell-Surface GH9 Endo-Glucanase Coordinates with Surface Glycan-Binding Proteins to Mediate Xyloglucan Uptake in the Gut Symbiont Bacteroides ovatus.
16	PDB:6n7rK	0.223	0.247	8.010	124	0.121	0.137	6n7rK.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0P1J1R0	5.50e-81	237	172	0.843	0.686	A0A0P1J1R0_HUMAN Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=seTCTP PE=3 SV=1
2	P13693	5.50e-81	237	172	0.843	0.686	TCTP_HUMAN Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
3	Q5W0H4	1.02e-80	237	188	0.843	0.628	Q5W0H4_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
4	A0A0B4J2C3	5.87e-80	236	197	0.843	0.599	A0A0B4J2C3_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
5	P63028	1.77e-77	228	172	0.800	0.651	TCTP_MOUSE Translationally-controlled tumor protein OS=Mus musculus OX=10090 GN=Tpt1 PE=1 SV=1
6	P63029	1.77e-77	228	172	0.800	0.651	TCTP_RAT Translationally-controlled tumor protein OS=Rattus norvegicus OX=10116 GN=Tpt1 PE=1 SV=1
7	E9PJF7	1.06e-74	221	162	0.786	0.679	E9PJF7_HUMAN Tumor protein, translationally-controlled 1 (Fragment) OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
8	J3KPG2	4.88e-74	219	160	0.779	0.681	J3KPG2_HUMAN Tumor protein, translationally-controlled 1 OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1
9	Q7ZYF2	6.16e-46	149	172	0.543	0.442	TCTP_XENLA Translationally-controlled tumor protein homolog OS=Xenopus laevis OX=8355 GN=tpt1 PE=1 SV=1
10	Q9VGS2	5.24e-22	87.8	172	0.400	0.326	TCTP_DROME Translationally-controlled tumor protein homolog OS=Drosophila melanogaster OX=7227 GN=Tctp PE=1 SV=1
11	Q10344	5.17e-17	75.1	168	0.393	0.327	TCTP_SCHPO Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=p23fy PE=1 SV=1
12	P35691	9.11e-17	74.3	167	0.321	0.269	TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMA19 PE=1 SV=1
13	Q5A860	6.13e-16	72.0	167	0.336	0.281	TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TMA19 PE=3 SV=1
14	Q8I3Z5	1.05e-15	71.6	171	0.343	0.281	TCTP_PLAF7 Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TCTP PE=1 SV=1
15	Q54RX6	2.40e-15	70.9	174	0.350	0.282	TCTP1_DICDI Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282853 PE=3 SV=1
16	P31265	4.61e-13	64.7	168	0.343	0.286	TCTP1_ARATH Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana OX=3702 GN=TCTP1 PE=1 SV=2
17	Q93573	8.60e-11	58.9	181	0.286	0.221	TCTP_CAEEL Translationally-controlled tumor protein homolog OS=Caenorhabditis elegans OX=6239 GN=tct-1 PE=1 SV=1
18	Q57TT8	2.44e-07	49.3	170	0.264	0.218	Q57TT8_TRYB2 Translationally controlled tumor protein (TCTP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.660 PE=3 SV=1
19	Q9M9V9	8.00e-05	42.4	156	0.264	0.237	TCTP2_ARATH Translationally controlled tumor protein 2 OS=Arabidopsis thaliana OX=3702 GN=TCTP2 PE=1 SV=1
20	Q57TT7	8.65e-04	39.7	170	0.157	0.129	Q57TT7_TRYB2 IgE-dependent histamine-releasing factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.670 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00838 TCTP	1.5e-39	147.5	Translationally controlled tumour protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003805310.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003819315.1	0.955	Eukaryotic translation elongation factor 2
2	9597.XP_003820835.1	0.946	Belongs to the EF-1-beta/EF-1-delta family.
3	9597.XP_003818255.1	0.937	Belongs to the universal ribosomal protein uS15 family.
4	9597.XP_003832232.1	0.936	Ribosomal protein L9
5	9597.XP_003820076.1	0.932	Belongs to the eukaryotic ribosomal protein eS25 family.
6	9597.XP_003810030.1	0.931	Ribosomal protein S28
7	9597.XP_003805122.1	0.929	Belongs to the eukaryotic ribosomal protein P1/P2 family.
8	9597.XP_003814749.1	0.928	Belongs to the universal ribosomal protein uS3 family.
9	9597.XP_008958754.1	0.928	60S ribosomal protein L5
10	9597.XP_008963519.1	0.926	Belongs to the eukaryotic ribosomal protein eS8 family.
11	9597.XP_003812284.1	0.925	Belongs to the universal ribosomal protein uS9 family.
12	9597.XP_003816691.1	0.923	Belongs to the universal ribosomal protein uS7 family.
13	9597.XP_003826297.1	0.922	Ribosomal protein L32
14	9597.XP_008964170.1	0.922	Belongs to the eukaryotic ribosomal protein eL38 family.
15	9597.XP_008964764.1	0.922	Belongs to the eukaryotic ribosomal protein eL27 family.
16	9597.XP_008953844.1	0.918	Belongs to the universal ribosomal protein uS4 family.
17	9597.XP_003821977.1	0.917	60S ribosomal protein L24
18	9597.XP_003806493.1	0.915	Ribosomal protein L35a
19	9597.XP_003826212.1	0.915	Belongs to the eukaryotic ribosomal protein eL15 family.
20	9597.XP_003809884.1	0.914	Belongs to the eukaryotic ribosomal protein eL19 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.730	ion binding
GO:1901363	0.481	heterocyclic compound binding
GO:0097159	0.480	organic cyclic compound binding
GO:0003676	0.468	nucleic acid binding
GO:0003723	0.376	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.971	biological regulation
GO:0050789	0.954	regulation of biological process
GO:0009987	0.730	cellular process
GO:0050794	0.670	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.963	cytosol
GO:0043226	0.953	organelle
GO:0043227	0.910	membrane-bounded organelle
GO:0043229	0.835	intracellular organelle
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0043232	0.626	intracellular non-membrane-bounded organelle
GO:0032991	0.500	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]