StarFunc result for job id Q587J7

User Input

>input (1177 residues)
MLQLLVLKIEDPGCFWVIIKGCSPFLDHDVDYQKLNSAMNDFYNSTCQDIEIKPLTLEEG
QVCVVYCEELKCWCRAIVKSITSSADQYLAECFLVDFAKNIPVKSKNIRVVVESFMQLPY
RAKKFSLYCTKPVTLHIDFCRDSTDIVPAKKWDNAAIQYFQNLLKATTQVEARLCAVEED
TFEVYLYVTIKDEKVCVNDDLVAKNYACYMSPTKNKNLDYLEKPRLNIKSAPSFNKLNPA
LTLWPMFLQGKDVQGMEDSHGVNFPAQSLQHTWCKGIVGDLRPTATAQDKAVKCNMDSLR
DSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIYADPDVPEASALSQKSNEKPLRL
TEKKEYDEKNSCVKLLQFLNPDPLRADGISDLQQLQKLKGLQPPVVVLRNKIKPCLTIDS
SPLSADLKKALQRNKFPGPSHTESYSWPPIARGCDVVVISHCESNPLLYLLPVLTVLQTG
ACYKSLPSRNGPLAVIVCPGWKKAQFIFELLGEYSMSSRPLHPVLLTIGLHKEEAKNTKL
PRGCDVIVTTPYSLLRLLACQSLLFLRLCHLILDEVEVLFLEANEQMFAILDNFKKNIEV
EERESAPHQIVAVGVHWNKHIEHLIKEFMNDPYIVITAMEEAALYGNVQQVVHLCLECEK
TSSLLQALDFIPSQAQKTLIFTCSVAETEIVCKVVESSSIFCLKMHKEMIFNLQNVLEQW
KKKLSSGSQIILALTDDCVPLLAITDATCVIHFSFPASPKVFGGRLYCMSDHFHAEQGSP
AEQGDKKAKSVLLLTEKDASHAVGVLRYLERADAKVPAELYEFTAGVLEAKEDKKAGRPL
CPYLKAFGFCKDKRICPDRHRINPETDLPRKLSSQALPSFGYIKIIPFYILNATNYFGRI
VDKHMDLYATLNAEMNEYFKDSNKTTVEKVEKFGLYGLAEKTLFHRVQVLEVNQKEDAWA
LDDILVEFIDEGRTGLVTRDQLLHLPEHFHTLPPQAVEFIVCRVKPADNEIEWNPKVTRY
IHHKIVGKLHDAKVILALGNTVWIDPMVHITNLSSLKTSVIDYNVRAEILSMGMGIDNPE
HIEQLKKLREDAKIPACEESLSQTPPRVTGTSPAQDQDHPSEEQGGQGTPPAEDAACLQS
PQPEDTGAEGGAESKTSSENQKPGGYLVFKRWLSSNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QPQ1	0.590	0.498	0.000	1403	0.375	0.314	A0A2R8QPQ1.pdb.gz
2	AFDB:Q9CWU0	0.613	0.595	0.000	1215	0.696	0.674	Q9CWU0.pdb.gz	TDR12_MOUSE Putative ATP-dependent RNA helicase TDRD12 OS=Mus musculus OX=10090 GN=Tdrd12 PE=1 SV=2
3	AFDB:Q1XG89	0.511	0.352	2.175E-57	1759	0.191	0.128	Q1XG89.pdb.gz	TDR12_BOMMO Putative ATP-dependent RNA helicase TDRD12 OS=Bombyx mori OX=7091 GN=TDRD12 PE=1 SV=2
4	AFDB:Q38DF6	0.180	0.276	2.540E-24	735	0.083	0.133	Q38DF6.pdb.gz	Q38DF6_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3510 PE=3 SV=1
5	AFDB:P19109	0.188	0.296	2.121E-23	719	0.102	0.167	P19109.pdb.gz	DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3
6	AFDB:Q9VHP0	0.186	0.265	2.121E-23	798	0.087	0.128	Q9VHP0.pdb.gz	DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster OX=7227 GN=bel PE=1 SV=1
7	AFDB:Q91372	0.188	0.303	7.024E-23	700	0.089	0.150	Q91372.pdb.gz	DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis OX=8355 GN=ddx4 PE=2 SV=1
8	AFDB:Q5W5U4	0.190	0.295	1.278E-22	729	0.088	0.143	Q5W5U4.pdb.gz	DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus OX=9913 GN=DDX4 PE=2 SV=1
9	AFDB:D0PV95	0.186	0.296	4.719E-22	708	0.077	0.129	D0PV95.pdb.gz	DDX3_CAEEL ATP-dependent RNA helicase laf-1 OS=Caenorhabditis elegans OX=6239 GN=laf-1 PE=1 SV=1
10	AFDB:F6S8Q4	0.170	0.296	5.089E-20	629	0.081	0.151	F6S8Q4.pdb.gz	F6S8Q4_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=1
11	PDB:7evoE	0.203	0.428	5.900E-20	455	0.076	0.198	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
12	PDB:7oqbp	0.194	0.459	9.312E-18	444	0.077	0.205	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6qw65X	0.173	0.335	2.107E-17	583	0.074	0.149	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:7evnE	0.186	0.426	2.619E-17	486	0.077	0.187	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
15	PDB:1fuuB	0.207	0.518	1.494E-16	380	0.062	0.192	1fuuB.pdb.gz
16	PDB:7pq0B	0.179	0.494	3.032E-16	385	0.065	0.197	7pq0B.pdb.gz
17	PDB:3ex7C	0.169	0.460	9.005E-16	392	0.063	0.189	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
18	PDB:7pliA	0.167	0.403	1.025E-13	457	0.057	0.147	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
19	PDB:5zwny	0.215	0.531	1.866E-13	399	0.060	0.178	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
20	PDB:1xtkA	0.157	0.450	1.124E-12	382	0.058	0.178	1xtkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CWU0	0.0	1061	1215	0.452	0.438	TDR12_MOUSE Putative ATP-dependent RNA helicase TDRD12 OS=Mus musculus OX=10090 GN=Tdrd12 PE=1 SV=2
2	Q1XG89	1.12e-44	179	1759	0.159	0.106	TDR12_BOMMO Putative ATP-dependent RNA helicase TDRD12 OS=Bombyx mori OX=7091 GN=TDRD12 PE=1 SV=2
3	Q8W4R3	1.34e-20	99.8	591	0.079	0.157	RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana OX=3702 GN=RH30 PE=1 SV=2
4	Q9XUW5	1.53e-20	99.4	561	0.087	0.182	Q9XUW5_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-17 PE=1 SV=1
5	Q61656	1.42e-19	96.7	614	0.073	0.140	DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus OX=10090 GN=Ddx5 PE=1 SV=2
6	P17844	1.55e-19	96.7	614	0.072	0.138	DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1
7	Q6AYI1	1.71e-19	96.7	615	0.072	0.138	Q6AYI1_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
8	B6DTP5	1.80e-19	96.3	614	0.072	0.138	B6DTP5_RAT Probable ATP-dependent RNA helicase DDX5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=2 SV=1
9	P19109	2.05e-19	96.7	719	0.076	0.125	DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3
10	J3KTA4	2.25e-19	96.3	614	0.073	0.140	J3KTA4_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1
11	A0A8I5ZKV9	2.31e-19	96.3	617	0.072	0.138	A0A8I5ZKV9_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
12	Q86TM3	2.64e-18	92.8	631	0.082	0.154	DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens OX=9606 GN=DDX53 PE=1 SV=3
13	A0A8I5ZYB4	9.05e-18	90.9	612	0.073	0.141	A0A8I5ZYB4_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
14	A0A8I6G4Y3	1.51e-17	89.4	478	0.070	0.172	A0A8I6G4Y3_RAT Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1
15	Q9SQV1	1.82e-17	90.9	1088	0.090	0.097	RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana OX=3702 GN=RH40 PE=2 SV=1
16	A0A0G2JLI4	1.98e-17	89.4	509	0.070	0.161	A0A0G2JLI4_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=2
17	P24783	3.74e-17	88.6	546	0.074	0.159	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
18	Q6NWH7	8.81e-17	87.4	496	0.076	0.181	Q6NWH7_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
19	F1Q5L6	1.44e-16	87.0	617	0.076	0.144	F1Q5L6_DANRE RNA helicase OS=Danio rerio OX=7955 GN=wu:fa56a07 PE=1 SV=1
20	P24782	1.80e-16	86.7	550	0.065	0.140	DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	0.0019	29.5	DEAD/DEAH box helicase
2	PF00271 Helicase_C	21	16.8	Helicase conserved C-terminal domain
3	PF00567 TUDOR	8.9e-28	108.2	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008967510.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003825654.1	0.889	Tudor domain-containing protein 1 isoform X1
2	9597.XP_003808375.1	0.850	HEN1 methyltransferase homolog 1
3	9597.XP_003808696.1	0.828	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 isoform X1
4	9597.XP_003817790.1	0.813	Belongs to the DEAD box helicase family.
5	9597.XP_008957298.1	0.812	Tudor domain containing 9
6	9597.XP_008970093.1	0.810	Drosha ribonuclease III
7	9597.XP_003812088.1	0.804	Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome
8	9597.XP_003804527.1	0.803	Inactive peptidyl-prolyl cis-trans isomerase FKBP6-like
9	9597.XP_003815624.1	0.803	FK506 binding protein 6
10	9597.XP_003812904.1	0.801	EBNA1 binding protein 2
11	9597.XP_008975485.1	0.790	Belongs to the argonaute family.
12	9597.XP_003819553.1	0.789	Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome
13	9597.XP_003824757.1	0.757	Tudor domain-containing protein 5 isoform X1
14	9597.XP_003811079.1	0.756	Mov10 RISC complex RNA helicase like 1
15	9597.XP_003817990.2	0.752	DExD-box helicase 52
16	9597.XP_003832856.1	0.749	ATP-dependent RNA helicase DDX24
17	9597.XP_003804557.1	0.745	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
18	9597.XP_008949278.1	0.743	Programmed cell death 11
19	9597.XP_003816616.1	0.741	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
20	9597.XP_008959720.1	0.738	DEAD-box helicase 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.995	nucleic acid binding
GO:0003723	0.991	RNA binding
GO:0003824	0.980	catalytic activity
GO:0140098	0.944	catalytic activity, acting on RNA
GO:0004386	0.933	helicase activity
GO:0003724	0.900	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0090304	0.974	nucleic acid metabolic process
GO:0016070	0.954	RNA metabolic process
GO:0032502	0.927	developmental process
GO:0006396	0.886	RNA processing
GO:0007276	0.865	gamete generation
GO:0010468	0.850	regulation of gene expression
GO:0034660	0.844	ncRNA metabolic process
GO:0071840	0.713	cellular component organization or biogenesis
GO:0044260	0.592	cellular macromolecule metabolic process
GO:0034470	0.591	ncRNA processing
GO:0022412	0.557	cellular process involved in reproduction in multicellular organism
GO:0006304	0.544	DNA modification
GO:0050794	0.542	regulation of cellular process
GO:0007283	0.510	spermatogenesis
GO:0006305	0.456	DNA alkylation
GO:0048519	0.401	negative regulation of biological process
GO:0043414	0.386	macromolecule methylation
GO:0010629	0.353	negative regulation of gene expression
GO:0031047	0.302	RNA-mediated gene silencing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0005829	0.987	cytosol
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0043233	0.933	organelle lumen
GO:0043231	0.910	intracellular membrane-bounded organelle
GO:0070013	0.906	intracellular organelle lumen
GO:0005634	0.403	nucleus
GO:1990923	0.373	PET complex
GO:0031981	0.366	nuclear lumen
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.900	RNA helicase.

[back to server]