StarFunc result for job id Q587J8

User Input

>input (217 residues)
MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGG
ERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGK
ALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQ
QSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q587J8	1.000	1.000	3.918E-35	217	1.000	1.000	Q587J8.pdb.gz	KHDC3_HUMAN KH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KHDC3L PE=1 SV=1
2	AFDB:Q9CWU5	0.504	0.264	6.282E-13	440	0.369	0.182	Q9CWU5.pdb.gz	KHDC3_MOUSE KH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Khdc3 PE=1 SV=1
3	AFDB:A6NGQ2	0.451	0.648	3.050E-8	149	0.161	0.235	A6NGQ2.pdb.gz	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
4	AFDB:Q9CWE6	0.395	0.505	8.322E-8	164	0.152	0.201	Q9CWE6.pdb.gz	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
5	AFDB:E9QEX9	0.282	0.026	1.648E-4	2607	0.212	0.018	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
6	AFDB:M9NEH9	0.278	0.113	5.779E-4	573	0.134	0.051	M9NEH9.pdb.gz	M9NEH9_DROME Mushroom-body expressed, isoform K OS=Drosophila melanogaster OX=7227 GN=mub PE=1 SV=1
7	AFDB:Q9GZT1	0.247	0.139	6.551E-4	424	0.134	0.068	Q9GZT1.pdb.gz	Q9GZT1_HUMAN Poly(RC) binding protein 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=PCBP4 PE=2 SV=1
8	AFDB:Q7SYM7	0.287	0.146	6.975E-4	493	0.175	0.077	Q7SYM7.pdb.gz
9	AFDB:F1R159	0.306	0.138	1.391E-3	569	0.152	0.058	F1R159.pdb.gz
10	AFDB:A0A0A0MQZ8	0.305	0.081	1.679E-3	866	0.166	0.042	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
11	PDB:6w17D	0.260	0.202	3.158E-1	301	0.074	0.053	6w17D.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
12	PDB:7mq8NY	0.240	0.193	3.362E-1	274	0.032	0.026	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6v7wE	0.136	0.131	3.580E-1	234	0.097	0.090	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
14	PDB:7vbaK	0.152	0.245	3.580E-1	108	0.074	0.148	7vbaK.pdb.gz	Structure of the human RNA polymerase I elongation complex.
15	PDB:4v6wCX	0.167	0.247	5.216E-1	120	0.060	0.108	4v6wCX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:7dl8A	0.148	0.234	7.600E-1	114	0.069	0.132	7dl8A.pdb.gz
17	PDB:3i4mK	0.209	0.326	8.092E-1	116	0.074	0.138	3i4mK.pdb.gz	Molecular basis of transcriptional mutagenesis at 8-oxoguanine
18	PDB:7btbX	0.158	0.219	8.092E-1	141	0.088	0.135	7btbX.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:7v61B	0.153	0.050	8.092E-1	751	0.055	0.016	7v61B.pdb.gz
20	PDB:1l3lB	0.126	0.119	8.615E-1	233	0.065	0.060	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q587J8	2.40e-160	443	217	1.000	1.000	KHDC3_HUMAN KH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KHDC3L PE=1 SV=1
2	F6SZT2	1.29e-137	385	206	0.885	0.932	KHDC3_MACMU KH domain-containing protein 3 OS=Macaca mulatta OX=9544 GN=KHDC3L PE=2 SV=2
3	Q9CWU5	1.50e-30	118	440	0.419	0.207	KHDC3_MOUSE KH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Khdc3 PE=1 SV=1
4	A6NGQ2	7.31e-13	65.9	149	0.152	0.221	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
5	Q9CWE6	1.63e-11	62.4	164	0.134	0.177	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
6	Q9CQS7	0.004	38.1	118	0.101	0.186	DPA5A_MOUSE Developmental pluripotency-associated protein 5A OS=Mus musculus OX=10090 GN=Dppa5a PE=1 SV=2
7	Q2L4Q9	0.96	32.7	553	0.120	0.047	PRS53_HUMAN Serine protease 53 OS=Homo sapiens OX=9606 GN=PRSS53 PE=1 SV=1
8	A1Z6I7	2.6	31.6	1460	0.092	0.014	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
9	Q7KN56	2.6	31.6	1484	0.092	0.013	Q7KN56_DROME LD23835p (Fragment) OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=2 SV=1
10	O76755	2.8	31.6	1461	0.092	0.014	O76755_DROME Mitotic checkpoint control protein kinase BUB1 OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=2 SV=1
11	O53670	4.1	30.8	646	0.092	0.031	O53670_MYCTU Probable succinate dehydrogenase [iron-sulfur subunit] (Succinic dehydrogenase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0248c PE=1 SV=1
12	Q8IHP3	6.2	30.4	2055	0.101	0.011	Q8IHP3_PLAF7 Membrane associated erythrocyte binding-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147800.1 PE=4 SV=1
13	Q9VQ91	9.9	29.6	576	0.078	0.030	TDRKH_DROME Tudor and KH domain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=papi PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	27	16.0	KH domain
2	PF16005 MOEP19	4.4e-33	124.4	KH-like RNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359392

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467123	0.925	NACHT, LRR and PYD domains-containing protein 7
2	9606.ENSP00000359411	0.924	KH homology domain-containing protein 1
3	9606.ENSP00000246112	0.898	Transducin-like enhancer protein 6
4	9606.ENSP00000375063	0.795	NACHT, LRR and PYD domains-containing protein 5
5	9606.ENSP00000445135	0.739	NACHT, LRR and PYD domains-containing protein 2
6	9606.ENSP00000007699	0.697	Y-box-binding protein 2
7	9606.ENSP00000333097	0.693	Factor in the germline alpha
8	9606.ENSP00000483125	0.687	Protein-arginine deiminase type-6
9	9606.ENSP00000419457	0.609	Homeobox protein NOBOX
10	9606.ENSP00000418259	0.606	ZFP57 zinc finger protein
11	9606.ENSP00000390621	0.602	Putative ATP-dependent RNA helicase TDRD12
12	9606.ENSP00000302770	0.594	Zinc finger protein 296
13	9606.ENSP00000460971	0.592	Zona pellucida sperm-binding protein 2
14	9606.ENSP00000367942	0.576	Growth/differentiation factor 9
15	9606.ENSP00000339136	0.518	GTPase ERas
16	9606.ENSP00000393154	0.515	F-box only protein 15
17	9606.ENSP00000331745	0.508	Growth/differentiation factor 3
18	9606.ENSP00000335578	0.506	Arginine-fifty homeobox

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.536	heterocyclic compound binding
GO:0097159	0.536	organic cyclic compound binding
GO:0003676	0.533	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0031323	0.905	regulation of cellular metabolic process
GO:0048518	0.889	positive regulation of biological process
GO:0019219	0.885	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.884	positive regulation of cellular process
GO:0010604	0.878	positive regulation of macromolecule metabolic process
GO:0051173	0.866	positive regulation of nitrogen compound metabolic process
GO:0048583	0.801	regulation of response to stimulus
GO:0045935	0.797	positive regulation of nucleobase-containing compound metabolic process
GO:0048584	0.769	positive regulation of response to stimulus
GO:0045739	0.721	positive regulation of DNA repair
GO:2000781	0.713	positive regulation of double-strand break repair
GO:0010569	0.708	regulation of double-strand break repair via homologous recombination
GO:0045911	0.425	positive regulation of DNA recombination
GO:0009987	0.384	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0106333	0.737	subcortical maternal complex
GO:0043232	0.305	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]