StarFunc result for job id Q58A45

User Input

>input (887 residues)
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLG
DPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
EGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q58A45	1.000	1.000	0.000	887	1.000	1.000	Q58A45.pdb.gz	PAN3_HUMAN PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3 PE=1 SV=3
2	PDB:6r5kO	0.391	0.728	8.005E-21	447	0.139	0.275	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
3	AFDB:Q9HFF4	0.223	0.197	2.154E-9	1023	0.133	0.115	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2
4	PDB:6s73A	0.204	0.593	2.776E-9	269	0.061	0.201	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
5	AFDB:P53739	0.194	0.193	2.068E-8	893	0.136	0.135	P53739.pdb.gz	FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPK1 PE=1 SV=1
6	AFDB:Q5B953	0.219	0.232	3.119E-8	828	0.144	0.155	Q5B953.pdb.gz	Q5B953_EMENI Checkpoint protein kinase, putative (AFU_orthologue AFUA_3G08100) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02927 PE=4 SV=1
7	PDB:4yc3A	0.184	0.487	5.760E-8	295	0.044	0.132	4yc3A.pdb.gz
8	AFDB:P07527	0.218	0.220	7.473E-8	877	0.134	0.136	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
9	PDB:7qwkE	0.186	0.573	9.630E-8	241	0.041	0.149	7qwkE.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
10	AFDB:M9PDQ2	0.215	0.191	1.249E-7	1011	0.157	0.137	M9PDQ2.pdb.gz	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
11	PDB:4eomC	0.206	0.571	2.082E-7	276	0.055	0.178	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:3uc3A	0.201	0.571	2.692E-7	272	0.052	0.169	3uc3A.pdb.gz	Structural basis for basal activity and autoactivation of abscisic acid (ABA) signaling SnRK2 kinases.
13	PDB:4c0tA	0.202	0.537	2.692E-7	291	0.047	0.144	4c0tA.pdb.gz
14	PDB:1unlA	0.198	0.539	2.834E-7	292	0.054	0.164	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:5x3fB	0.191	0.440	2.983E-7	349	0.054	0.138	5x3fB.pdb.gz
16	PDB:4d28C	0.216	0.619	3.481E-7	279	0.059	0.186	4d28C.pdb.gz
17	AFDB:G5EB22	0.190	0.163	6.147E-7	1050	0.148	0.125	G5EB22.pdb.gz	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
18	AFDB:Q14004	0.173	0.111	1.028E-6	1512	0.136	0.080	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
19	AFDB:P0CY24	0.201	0.149	1.139E-6	1228	0.129	0.093	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
20	AFDB:F4HQ88	0.217	0.169	1.473E-6	1169	0.134	0.102	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q58A45	0.0	1835	887	1.000	1.000	PAN3_HUMAN PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3 PE=1 SV=3
2	Q640Q5	0.0	1375	837	0.821	0.870	PAN3_MOUSE PAN2-PAN3 deadenylation complex subunit Pan3 OS=Mus musculus OX=10090 GN=Pan3 PE=1 SV=4
3	Q95RR8	1.44e-168	511	790	0.290	0.325	PAN3_DROME PAN2-PAN3 deadenylation complex subunit PAN3 OS=Drosophila melanogaster OX=7227 GN=PAN3 PE=1 SV=1
4	D3DMN9	3.62e-168	511	807	0.290	0.318	D3DMN9_DROME LD10418p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG11486-RC PE=1 SV=1
5	P34653	1.41e-109	352	632	0.228	0.320	PAN3_CAEEL PAN2-PAN3 deadenylation complex subunit PAN3 OS=Caenorhabditis elegans OX=6239 GN=panl-3 PE=1 SV=3
6	G0S0Y3	3.09e-99	325	640	0.201	0.278	PAN3_CHATD PAN2-PAN3 deadenylation complex subunit PAN3 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=PAN3 PE=1 SV=2
7	Q7SDP4	1.81e-79	272	656	0.182	0.245	PAN3_NEUCR PAN2-PAN3 deadenylation complex subunit pan3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=par-2 PE=1 SV=2
8	P36102	8.21e-50	189	679	0.142	0.186	PAN3_YEAST PAN2-PAN3 deadenylation complex subunit PAN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN3 PE=1 SV=1
9	O13865	8.74e-49	186	681	0.157	0.204	PAN3L_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit pan3-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B1.04c PE=1 SV=2
10	Q9UST1	3.51e-41	162	589	0.129	0.194	PAN3_SCHPO PAN2-PAN3 deadenylation complex subunit pan3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk26 PE=3 SV=1
11	Q382E0	1.77e-23	107	512	0.115	0.199	Q382E0_TRYB2 Pab1p-dependent poly(A) ribonuclease subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5540 PE=4 SV=1
12	G5EFM9	5.84e-10	63.9	302	0.053	0.156	NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans OX=6239 GN=nekl-3 PE=1 SV=1
13	Q8TDX7	6.45e-10	63.5	302	0.047	0.139	NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1
14	D3ZBE5	1.50e-09	62.4	302	0.047	0.139	NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=1 SV=1
15	Q9ES74	2.10e-09	62.0	302	0.047	0.139	NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus OX=10090 GN=Nek7 PE=1 SV=1
16	Q5TBH1	3.05e-07	54.3	222	0.054	0.216	Q5TBH1_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
17	Q5TBG1	3.14e-07	54.3	207	0.054	0.232	Q5TBG1_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
18	Q5TBG7	3.41e-07	54.3	219	0.054	0.219	Q5TBG7_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
19	Q5TBH2	3.45e-07	54.3	220	0.054	0.218	Q5TBH2_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
20	Q9HC98	1.14e-06	53.9	313	0.054	0.153	NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18101 Pan3_PK	4.6e-59	209.8	Pan3 Pseudokinase domain
2	PF00069 Pkinase	5	18.0	Protein kinase domain
3	PF16131 Torus	1.6e+02	14.3	Torus domain
4	PF00642 zf-CCCH	0.81	21.0	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
5	PF18044 zf-CCCH_4	18	16.5	CCCH-type zinc finger
6	PF18345 zf_CCCH_4	5	18.5	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401721	0.999	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
2	9606.ENSP00000313007	0.997	Polyadenylate-binding protein 1
3	9606.ENSP00000388806	0.912	Eukaryotic translation initiation factor 4B
4	9606.ENSP00000269349	0.908	Eukaryotic initiation factor 4A-III
5	9606.ENSP00000293831	0.908	Eukaryotic initiation factor 4A-I
6	9606.ENSP00000326381	0.908	Eukaryotic initiation factor 4A-II
7	9606.ENSP00000416255	0.905	Eukaryotic translation initiation factor 4 gamma 1
8	9606.ENSP00000425561	0.905	Eukaryotic translation initiation factor 4E
9	9606.ENSP00000302768	0.904	Polyadenylate-binding protein-interacting protein 1
10	9606.ENSP00000336783	0.904	Trinucleotide repeat-containing gene 6C protein
11	9606.ENSP00000282516	0.848	Nipped-B-like protein
12	9606.ENSP00000281589	0.781	Polyadenylate-binding protein 3
13	9606.ENSP00000255136	0.712	Polyadenylate-binding protein 1-like
14	9606.ENSP00000361949	0.712	Polyadenylate-binding protein 4
15	9606.ENSP00000313199	0.670	Heterogeneous nuclear ribonucleoprotein D0
16	9606.ENSP00000307208	0.669	Nucleosome-remodeling factor subunit BPTF
17	9606.ENSP00000325290	0.643	Serine/threonine-protein kinase haspin
18	9606.ENSP00000351524	0.630	Probable helicase with zinc finger domain
19	9606.ENSP00000276616	0.608	Protein serine kinase H2
20	9606.ENSP00000379144	0.602	Trinucleotide repeat-containing gene 6A protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.998	catalytic activity
GO:0140640	0.986	catalytic activity, acting on a nucleic acid
GO:0016787	0.976	hydrolase activity
GO:0016788	0.973	hydrolase activity, acting on ester bonds
GO:0004527	0.955	exonuclease activity
GO:0008408	0.951	3'-5' exonuclease activity
GO:0016896	0.951	RNA exonuclease activity, producing 5'-phosphomonoesters
GO:0004535	0.936	poly(A)-specific ribonuclease activity
GO:1901363	0.443	heterocyclic compound binding
GO:0097159	0.443	organic cyclic compound binding
GO:0003723	0.430	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043488	0.996	regulation of mRNA stability
GO:0006401	0.996	RNA catabolic process
GO:0017148	0.996	negative regulation of translation
GO:0000288	0.992	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0110154	0.971	RNA decapping
GO:0110156	0.946	methylguanosine-cap decapping
GO:0051179	0.930	localization
GO:0051641	0.853	cellular localization
GO:0051128	0.825	regulation of cellular component organization
GO:0033043	0.649	regulation of organelle organization
GO:0044087	0.605	regulation of cellular component biogenesis
GO:0033036	0.507	macromolecule localization
GO:0070727	0.490	cellular macromolecule localization
GO:0051234	0.477	establishment of localization
GO:0051130	0.439	positive regulation of cellular component organization
GO:0044089	0.437	positive regulation of cellular component biogenesis
GO:0010638	0.429	positive regulation of organelle organization
GO:0051649	0.418	establishment of localization in cell
GO:0006810	0.404	transport
GO:0071702	0.375	organic substance transport
GO:1902117	0.335	positive regulation of organelle assembly
GO:0008104	0.329	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0032991	0.992	protein-containing complex
GO:0043229	0.977	intracellular organelle
GO:0043232	0.877	intracellular non-membrane-bounded organelle
GO:0099080	0.453	supramolecular complex
GO:0005634	0.437	nucleus
GO:0031251	0.389	PAN complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.976	Hydrolases.
EC:3.1.-.-	0.973	Acting on ester bonds.
EC:3.1.13.-	0.951	Exoribonucleases producing 5'-phosphomonoesters.
EC:3.1.13.4	0.936	poly(A)-specific ribonuclease.

[back to server]