StarFunc result for job id Q58EX7

User Input

>input (1191 residues)
MERPLENGDESPDSQGHATDWRFAVCSFRDAWEEEEPASQMHVKDPGPPRPPAGATQDEE
LQGSPLSRKFQLPPAADESGDAQRGTVESSSVLSEGPGPSGVESLLCPMSSHLSLAQGES
DTPGVGLVGDPGPSRAMPSGLSPGALDSDPVGLGDPLSEISKLLEAAPSGSGLPKPADCL
LAQDLCWELLASGMATLPGTRDVQGRAVLLLCAHSPAWLQSECSSQELIRLLLYLRSIPR
PEVQALGLTVLVDARICAPSSSLFSGLSQLQEAAPGAVYQVLLVGSTLLKEVPSGLQLEQ
LPSQSLLTHIPTAGLPTSLGGGLPYCHQAWLDFRRRLEALLQNCQAACALLQGAIESVKA
VPQPMEPGEVGQLLQQTEVLMQQVLDSPWLAWLQCQGGRELTWLKQEVPEVTLSPDYRTA
MDKADELYDRVDGLLHQLTLQSNQRIQALELVQTLEARESGLHQIEVWLQQVGWPALEEA
GEPSLDMLLQAQGSFQELYQVAQEQVRQGEKFLQPLTGWEAAELDPPGARFLALRAQLTE
FSRALAQRCQRLADAERLFQLFREALTWAEEGQRVLAELEQERPGVVLQQLQLHWTRHPD
LPPAHFRKMWALATGLGSEAIRQECRWAWARCQDTWLALDQKLEASLKLPPVGSTASLCV
SQVPAAPAHPPLRKAYSFDRNLGQSLSEPACHCHHAATIAACRRPEAGGGALPQASPTVP
PPGSSDPRSLNRLQLVLAEMVATEREYVRALEYTMENYFPELDRPDVPQGLRGQRAHLFG
NLEKLRDFHCHFFLRELEACTRHPPRVAYAFLRHRVQFGMYALYSKNKPRSDALMSSYGH
TFFKDKQQALGDHLDLASYLLKPIQRMGKYALLLQELARACGGPTQELSALREAQSLVHF
QLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFVVRTGRHKSVRRIFLFEELLLFSKPRH
GPTGVDTFAYKRSFKMADLGLTECCGNSNLRFEIWFRRRKARDTFVLQASSLAIKQAWTA
DISHLLWRQAVHNKEVRMAEMVSMGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRAS
IAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFPEEAALE
AEAELGGQPSLTAEDSEISSQCPSASGSSGSDSSCVSGQALGRGLEDLPCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q58EX7	1.000	1.000	0.000	1191	1.000	1.000	Q58EX7.pdb.gz	PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens OX=9606 GN=PLEKHG4 PE=1 SV=1
2	AFDB:A0A2R8RHL8	0.254	0.134	1.398E-29	2306	0.223	0.115	A0A2R8RHL8.pdb.gz	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
3	AFDB:Q7KVD1	0.269	0.151	4.193E-24	2263	0.152	0.080	Q7KVD1.pdb.gz	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
4	AFDB:Q86VW2	0.232	0.430	2.763E-21	580	0.113	0.231	Q86VW2.pdb.gz	ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens OX=9606 GN=ARHGEF25 PE=1 SV=2
5	AFDB:Q9ULL1	0.200	0.175	1.610E-18	1385	0.114	0.098	Q9ULL1.pdb.gz	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
6	AFDB:A1ZAQ3	0.217	0.354	2.325E-17	682	0.072	0.126	A1ZAQ3.pdb.gz	A1ZAQ3_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG15612 PE=4 SV=2
7	AFDB:Q9W0S0	0.172	0.193	4.269E-13	1026	0.076	0.088	Q9W0S0.pdb.gz	Q9W0S0_DROME LP23332p OS=Drosophila melanogaster OX=7227 GN=RhoGEF3 PE=2 SV=2
8	PDB:4mt6A	0.175	0.415	1.616E-12	389	0.056	0.172	4mt6A.pdb.gz
9	PDB:7rx9A	0.141	0.370	1.684E-12	432	0.061	0.169	7rx9A.pdb.gz
10	AFDB:Q8R4H2	0.189	0.150	2.300E-12	1543	0.165	0.128	Q8R4H2.pdb.gz	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
11	AFDB:O88387	0.141	0.215	6.424E-12	766	0.069	0.107	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
12	AFDB:Q96M96	0.142	0.217	7.889E-12	766	0.068	0.106	Q96M96.pdb.gz	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
13	PDB:4gouA	0.126	0.281	4.096E-5	507	0.039	0.091	4gouA.pdb.gz
14	PDB:6bbpA	0.084	0.163	1.652E-3	520	0.043	0.098	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:6u3eA	0.081	0.208	7.553E-3	397	0.041	0.123	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:4mk0A	0.077	0.135	1.139E-2	631	0.023	0.043	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:5yqrA	0.075	0.292	1.139E-2	268	0.024	0.104	5yqrA.pdb.gz
18	PDB:3ljuX	0.072	0.209	2.024E-2	373	0.013	0.043	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:1oizA	0.092	0.360	2.386E-2	265	0.028	0.125	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
20	PDB:3w68C	0.107	0.435	4.241E-2	252	0.029	0.135	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VPS6	0.0	1697	1181	0.752	0.759	F8VPS6_MOUSE Pleckstrin homology domain containing, family G (with RhoGef domain) member 4 OS=Mus musculus OX=10090 GN=Plekhg4 PE=1 SV=1
2	Q58EX7	0.0	2407	1191	1.000	1.000	PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens OX=9606 GN=PLEKHG4 PE=1 SV=1
3	Q96PX9	4.13e-129	429	1271	0.181	0.169	PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens OX=9606 GN=PLEKHG4B PE=1 SV=4
4	Q6DN89	3.80e-127	433	1989	0.169	0.101	Q6DN89_DANRE Quattro OS=Danio rerio OX=7955 GN=sb:cb9 PE=2 SV=1
5	Q7KU87	7.89e-121	397	872	0.165	0.226	Q7KU87_DROME FI18828p1 OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
6	Q86NW6	4.80e-118	397	1191	0.165	0.165	Q86NW6_DROME GM01778p OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
7	Q7KU88	4.50e-117	398	1428	0.165	0.138	Q7KU88_DROME Puratrophin-1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
8	M9PEF7	1.91e-115	398	1898	0.165	0.104	M9PEF7_DROME Puratrophin-1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=1
9	Q7KU89	2.41e-115	398	1904	0.165	0.103	Q7KU89_DROME Puratrophin-1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
10	Q8TER5	2.11e-81	295	1519	0.142	0.111	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
11	O75962	2.85e-52	204	3097	0.093	0.036	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
12	Q0KL02	1.16e-50	199	3102	0.092	0.035	TRIO_MOUSE Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3
13	F1M0Z1	1.70e-50	199	3100	0.091	0.035	TRIO_RAT Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4
14	Q8MSF1	5.21e-49	181	369	0.073	0.236	Q8MSF1_DROME GM23249p OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
15	O60229	1.96e-48	192	2986	0.092	0.037	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
16	H7BXZ5	2.08e-48	192	2955	0.092	0.037	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
17	Q1RLV0	1.40e-47	179	471	0.089	0.225	Q1RLV0_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=zgc:136817 PE=2 SV=1
18	P97924	4.15e-47	187	2959	0.089	0.036	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3
19	A0A0R4IJ99	1.04e-46	180	616	0.087	0.169	A0A0R4IJ99_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
20	A2CG49	1.15e-46	186	2964	0.088	0.035	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11558 HET-s_218-289	7.5e+02	11.5	Het-s 218-289
2	PF00169 PH	20	17.1	PH domain
3	PF15411 PH_10	70	15.1	Pleckstrin homology domain
4	PF00621 RhoGEF	3.4e-23	94.3	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432568	0.852	Spectrin beta chain, non-erythrocytic 2
2	9606.ENSP00000442793	0.729	Protein BEAN1
3	9606.ENSP00000370196	0.704	Myotubularin-related protein 5
4	9606.ENSP00000252934	0.681	Ataxin-10
5	9606.ENSP00000439585	0.681	Ataxin-7
6	9606.ENSP00000244769	0.676	Ataxin-1
7	9606.ENSP00000353362	0.665	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
8	9606.ENSP00000240316	0.640	Coilin
9	9606.ENSP00000211998	0.616	Vinculin
10	9606.ENSP00000305699	0.596	Protein Hook homolog 3
11	9606.ENSP00000327077	0.577	Pericentriolar material 1 protein
12	9606.ENSP00000357292	0.577	Ubiquilin-4
13	9606.ENSP00000377936	0.564	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
14	9606.ENSP00000267890	0.559	Tau-tubulin kinase 2
15	9606.ENSP00000334223	0.555	Proton-coupled amino acid transporter 2
16	9606.ENSP00000344961	0.546	Pleckstrin homology and RhoGEF domain containing G7
17	9606.ENSP00000285667	0.538	Heat shock 70 kDa protein 13
18	9606.ENSP00000474182	0.526	Leucine-, glutamate- and lysine-rich protein 1
19	9606.ENSP00000229390	0.520	Serine/arginine-rich splicing factor 9
20	9606.ENSP00000345195	0.520	Ubiquilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.975	regulation of cellular process
GO:0048583	0.936	regulation of response to stimulus
GO:0023051	0.904	regulation of signaling
GO:0010646	0.903	regulation of cell communication
GO:0051056	0.833	regulation of small GTPase mediated signal transduction
GO:0043087	0.790	regulation of GTPase activity
GO:0051345	0.775	positive regulation of hydrolase activity
GO:0043547	0.746	positive regulation of GTPase activity
GO:0090630	0.678	activation of GTPase activity
GO:0009987	0.547	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.862	membrane
GO:0043229	0.795	intracellular organelle
GO:0043231	0.640	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]