StarFunc result for job id Q58F21

User Input

>input (947 residues)
MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVK
LQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQ
ALEKLFMQKLSQMPQEEQVVGVKERIKKGTQQNIAVSSAKEKSSPSATEKVFKQQEIPSV
FPKTSISPLNVVQGASVNSSSQTAAQVTKGVKRKADTTTPATSAVKASSEFSPTFTEKSV
ALPPIKENMPKNVLPDSQQQYNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVD
VNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVT
MARMLQDVFETHFSKIPIEPVESMPLCYIKTDITETTGRENTNEASSEGNSSDDSEDERV
KRLAKLQEQLKAVHQQLQVLSQVPFRKLNKKKEKSKKEKKKEKVNNSNENPRKMCEQMRL
KEKSKRNQPKKRKQQFIGLKSEDEDNAKPMNYDEKRQLSLNINKLPGDKLGRVVHIIQSR
EPSLSNSNPDEIEIDFETLKASTLRELEKYVSACLRKRPLKPPAKKIMMSKEELHSQKKQ
ELEKRLLDVNNQLNSRKRQTKSDKTQPSKAVENVSRLSESSSSSSSSSESESSSSDLSSS
DSSDSESEMFPKFTEVKPNDSPSKENVKKMKNECIPPEGRTGVTQIGYCVQDTTSANTTL
VHQTTPSHVMPPNHHQLAFNYQELEHLQTVKNISPLQILPPSGDSEQLSNGITVMHPSGD
SDTTMLESECQAPVQKDIKIKNADSWKSLGKPVKPSGVMKSSDELFNQFRKAAIEKEVKA
RTQELIRKHLEQNTKELKASQENQRDLGNGLTVESFSNKIQNKCSGEEQKEHQQSSEAQD
KSKLWLLKDRDLARQKEQERRRREAMVGTIDMTLQSDIMTMFENNFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q58F21	1.000	1.000	0.000	947	1.000	1.000	Q58F21.pdb.gz	BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens OX=9606 GN=BRDT PE=1 SV=4
2	AFDB:Q91Y44	0.349	0.347	2.715E-85	956	0.728	0.721	Q91Y44.pdb.gz	BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus OX=10090 GN=Brdt PE=1 SV=3
3	AFDB:D4A7T3	0.257	0.256	5.270E-84	952	0.713	0.709	D4A7T3.pdb.gz	BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus OX=10116 GN=Brdt PE=1 SV=1
4	AFDB:Q15059	0.143	0.185	4.602E-51	726	0.392	0.511	Q15059.pdb.gz	BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1
5	AFDB:O60885	0.184	0.140	1.617E-50	1362	0.441	0.307	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
6	AFDB:A0A024RCR5	0.153	0.174	2.542E-50	801	0.403	0.477	A0A024RCR5.pdb.gz
7	AFDB:Q9ESU6	0.195	0.141	1.208E-49	1400	0.390	0.264	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
8	AFDB:Q8AWX9	0.146	0.165	4.737E-48	806	0.373	0.438	Q8AWX9.pdb.gz
9	AFDB:F1R5H6	0.211	0.151	8.234E-48	1444	0.453	0.297	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
10	AFDB:F1QQP6	0.207	0.278	1.664E-47	683	0.350	0.485	F1QQP6.pdb.gz	F1QQP6_DANRE Bromodomain-containing 3a OS=Danio rerio OX=7955 GN=brd3 PE=1 SV=1
11	PDB:5svan	0.058	0.255	2.415E-1	200	0.018	0.085	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:1x8zA	0.054	0.203	1.631	151	0.015	0.093	1x8zA.pdb.gz
13	PDB:4jaeA	0.041	0.071	1.804	426	0.021	0.047	4jaeA.pdb.gz	Enzyme-substrate complexes of allosteric citrate synthase: Evidence for a novel intermediate in substrate binding.
14	PDB:4cguA	0.050	0.262	3.467	112	0.019	0.161	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
15	PDB:7mq8LT	0.057	0.060	4.031	869	0.027	0.030	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:1rj1A	0.078	0.285	4.239	148	0.022	0.142	1rj1A.pdb.gz
17	PDB:2wj8N	0.046	0.094	4.929	378	0.014	0.034	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
18	PDB:6zonK	0.041	0.132	5.183	217	0.017	0.074	6zonK.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
19	PDB:7oniH	0.046	0.089	5.731	380	0.010	0.024	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
20	PDB:4mt6A	0.047	0.100	6.027	389	0.020	0.049	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A7T3	0.0	1170	952	0.703	0.700	BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus OX=10116 GN=Brdt PE=1 SV=1
2	H0Y6K2	0.0	588	807	0.378	0.444	H0Y6K2_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
3	P25440	0.0	588	801	0.378	0.447	BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2
4	Q58F21	0.0	1955	947	1.000	1.000	BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens OX=9606 GN=BRDT PE=1 SV=4
5	Q7JJ13	0.0	587	798	0.397	0.471	BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus OX=10090 GN=Brd2 PE=1 SV=1
6	Q91Y44	0.0	1217	956	0.718	0.711	BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus OX=10090 GN=Brdt PE=1 SV=3
7	Q15059	1.35e-177	534	726	0.360	0.470	BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1
8	F1QQP6	8.96e-174	523	683	0.341	0.473	F1QQP6_DANRE Bromodomain-containing 3a OS=Danio rerio OX=7955 GN=brd3 PE=1 SV=1
9	U3KQA6	1.80e-146	447	552	0.272	0.467	U3KQA6_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
10	O60885	2.86e-126	416	1362	0.251	0.175	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
11	Q9ESU6	5.27e-126	416	1400	0.253	0.171	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
12	H0Y799	2.01e-65	224	296	0.138	0.443	H0Y799_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
13	Q95Y80	2.41e-65	238	853	0.190	0.211	BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans OX=6239 GN=bet-1 PE=1 SV=3
14	F1R5H6	2.52e-61	230	1444	0.141	0.093	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
15	A8CYR7	2.95e-55	194	276	0.083	0.286	A8CYR7_DANRE Bromodomain-containing protein 2 OS=Danio rerio OX=7955 GN=brd2b PE=2 SV=1
16	Q1LWX7	9.63e-54	204	832	0.116	0.132	Q1LWX7_DANRE Bromodomain-containing 2 OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
17	A8CYR1	1.03e-53	204	836	0.116	0.132	A8CYR1_DANRE Bromodomain-containing 2a OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
18	P13709	1.21e-49	194	2038	0.101	0.047	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
19	P35817	3.12e-32	136	686	0.101	0.140	BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDF1 PE=1 SV=3
20	Q9VCG6	9.01e-26	114	513	0.108	0.199	Q9VCG6_DROME IP14417p1 OS=Drosophila melanogaster OX=7227 GN=tbrd-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17035 BET	2.3e-23	93.5	Bromodomain extra-terminal - transcription regulation
2	PF17105 BRD4_CDT	8.6e-20	81.2	C-terminal domain of bromodomain protein 4
3	PF00439 Bromodomain	2.1e-38	141.6	Bromodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387822

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323967	0.973	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
2	9606.ENSP00000244537	0.971	Histone cluster 1 H4 family member f
3	9606.ENSP00000297439	0.897	Beta-defensin 1
4	9606.ENSP00000484789	0.866	Histone H4
5	9606.ENSP00000362361	0.858	Cyclin-dependent kinase 9
6	9606.ENSP00000261900	0.784	Cyclin-T1
7	9606.ENSP00000262450	0.715	Chromodomain-helicase-DNA-binding protein 5
8	9606.ENSP00000312709	0.690	Transcription initiation factor TFIID subunit 7
9	9606.ENSP00000238146	0.686	ATP-dependent RNA helicase DDX55
10	9606.ENSP00000347168	0.682	Histone cluster 1 H4 family member j
11	9606.ENSP00000366956	0.682	Histone cluster 1 H4 family member h
12	9606.ENSP00000366974	0.682	Histone cluster 1 H4 family member b
13	9606.ENSP00000367034	0.682	Histone cluster 1 H4 family member c
14	9606.ENSP00000443017	0.682	Histone cluster 4, H4
15	9606.ENSP00000462355	0.682	Histone cluster 2 H4 family member b
16	9606.ENSP00000462667	0.682	Histone cluster 2 H4 family member a
17	9606.ENSP00000479106	0.682	Histone cluster 1 H4 family member a
18	9606.ENSP00000479461	0.682	Histone cluster 1 H4 family member d
19	9606.ENSP00000479794	0.682	Histone cluster 1 H4 family member k
20	9606.ENSP00000480960	0.682	Histone cluster 1 H4 family member l

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	1.000	histone binding
GO:0003713	1.000	transcription coactivator activity
GO:0003824	0.651	catalytic activity
GO:0140096	0.601	catalytic activity, acting on a protein
GO:0016740	0.533	transferase activity
GO:0003682	0.494	chromatin binding
GO:0140030	0.490	modification-dependent protein binding
GO:1901363	0.466	heterocyclic compound binding
GO:0097159	0.466	organic cyclic compound binding
GO:0003676	0.433	nucleic acid binding
GO:0070577	0.425	lysine-acetylated histone binding
GO:0003677	0.423	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0019219	0.984	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0009987	0.901	cellular process
GO:0048518	0.561	positive regulation of biological process
GO:0048522	0.491	positive regulation of cellular process
GO:0010604	0.457	positive regulation of macromolecule metabolic process
GO:0071840	0.456	cellular component organization or biogenesis
GO:0016043	0.429	cellular component organization
GO:0051173	0.387	positive regulation of nitrogen compound metabolic process
GO:0045935	0.365	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.344	positive regulation of RNA metabolic process
GO:0006357	0.338	regulation of transcription by RNA polymerase II
GO:0045893	0.327	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.973	nuclear lumen
GO:0005654	0.736	nucleoplasm
GO:0043232	0.496	intracellular non-membrane-bounded organelle
GO:0032991	0.492	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.533	Transferases.

[back to server]