StarFunc result for job id Q58G82

User Input

>input (188 residues)
MLEGFQILVQNTVQGTIHKIKCVCDSQMSVSEMSCSESTSACQSLEDGSVPEILISLLYN
ATNGRLSAEVIKGSHLKNWAANRPPNTYVKLTLRKSTDQEMSKCKISIRRGRPNPVYKET
FVFKVTLFQLSHVTLMLSVYNKSSMRRKMIGWIYLGLNSSGEELNHWTEMKESKGRQVRR
WQALLESR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q58G82	1.000	1.000	8.194E-37	188	1.000	1.000	Q58G82.pdb.gz	SY14L_HUMAN Putative synaptotagmin-14-like protein OS=Homo sapiens OX=9606 GN=SYT14P1 PE=5 SV=2
2	AFDB:Q7TN84	0.729	0.250	3.495E-24	555	0.697	0.236	Q7TN84.pdb.gz	SYT14_MOUSE Synaptotagmin-14 OS=Mus musculus OX=10090 GN=Syt14 PE=2 SV=1
3	AFDB:Q7TN83	0.724	0.217	9.303E-22	639	0.569	0.167	Q7TN83.pdb.gz	SYT16_MOUSE Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16 PE=1 SV=1
4	AFDB:Q17RD7	0.724	0.215	9.832E-22	645	0.569	0.166	Q17RD7.pdb.gz	SYT16_HUMAN Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 PE=1 SV=2
5	AFDB:Q95QH7	0.719	0.310	1.854E-14	443	0.239	0.102	Q95QH7.pdb.gz	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
6	AFDB:P29101	0.688	0.313	5.015E-14	422	0.191	0.085	P29101.pdb.gz	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
7	AFDB:P21579	0.707	0.321	8.249E-14	422	0.218	0.097	P21579.pdb.gz	SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1
8	AFDB:O43581	0.698	0.330	1.088E-13	403	0.229	0.107	O43581.pdb.gz	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
9	AFDB:P21521	0.677	0.274	2.358E-13	474	0.202	0.080	P21521.pdb.gz	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
10	AFDB:Q62746	0.690	0.261	3.109E-13	511	0.229	0.084	Q62746.pdb.gz	SYT6_RAT Synaptotagmin-6 OS=Rattus norvegicus OX=10116 GN=Syt6 PE=1 SV=1
11	PDB:3pfqA	0.556	0.214	1.490E-8	523	0.160	0.057	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:1cjyA	0.399	0.128	7.028E-5	633	0.090	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.409	0.119	8.296E-5	684	0.090	0.025	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:4rj9A	0.366	0.422	1.702E-4	161	0.090	0.106	4rj9A.pdb.gz
15	PDB:5a50A	0.349	0.394	1.799E-4	165	0.090	0.103	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5izrC	0.405	0.123	1.901E-4	659	0.085	0.024	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5a52A	0.376	0.452	2.372E-4	154	0.080	0.097	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5iz5B	0.400	0.108	2.372E-4	746	0.101	0.025	5iz5B.pdb.gz
19	PDB:4gnkB	0.372	0.101	3.127E-4	769	0.154	0.038	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
20	PDB:5iz5A	0.377	0.100	9.449E-4	757	0.112	0.028	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q58G82	2.04e-140	390	188	1.000	1.000	SY14L_HUMAN Putative synaptotagmin-14-like protein OS=Homo sapiens OX=9606 GN=SYT14P1 PE=5 SV=2
2	Q8NB59	2.20e-92	281	555	0.755	0.256	SYT14_HUMAN Synaptotagmin-14 OS=Homo sapiens OX=9606 GN=SYT14 PE=1 SV=2
3	Q7TN84	1.59e-85	264	555	0.702	0.238	SYT14_MOUSE Synaptotagmin-14 OS=Mus musculus OX=10090 GN=Syt14 PE=2 SV=1
4	Q17RD7	9.81e-66	214	645	0.559	0.163	SYT16_HUMAN Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 PE=1 SV=2
5	Q7TN83	3.45e-59	197	639	0.564	0.166	SYT16_MOUSE Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16 PE=1 SV=1
6	P70169	3.49e-16	77.4	412	0.250	0.114	DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus OX=10090 GN=Doc2b PE=1 SV=2
7	P70610	7.32e-16	76.6	412	0.250	0.114	DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus OX=10116 GN=Doc2b PE=1 SV=2
8	D4P8S0	2.12e-14	72.4	488	0.239	0.092	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
9	P40749	2.03e-13	69.7	425	0.213	0.094	SYT4_MOUSE Synaptotagmin-4 OS=Mus musculus OX=10090 GN=Syt4 PE=1 SV=2
10	P50232	2.09e-13	69.7	425	0.213	0.094	SYT4_RAT Synaptotagmin-4 OS=Rattus norvegicus OX=10116 GN=Syt4 PE=1 SV=1
11	Q9H2B2	2.11e-13	69.7	425	0.218	0.096	SYT4_HUMAN Synaptotagmin-4 OS=Homo sapiens OX=9606 GN=SYT4 PE=1 SV=1
12	P97610	2.59e-13	69.3	421	0.239	0.107	SYT12_RAT Synaptotagmin-12 OS=Rattus norvegicus OX=10116 GN=Syt12 PE=1 SV=1
13	O43581	3.72e-13	68.9	403	0.218	0.102	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
14	P34693	3.80e-13	68.9	441	0.239	0.102	SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=2 SV=1
15	Q9Y2J0	4.20e-13	68.9	694	0.218	0.059	RP3A_HUMAN Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1
16	P47708	4.69e-13	68.9	681	0.218	0.060	RP3A_MOUSE Rabphilin-3A OS=Mus musculus OX=10090 GN=Rph3a PE=1 SV=2
17	P47709	5.16e-13	68.6	684	0.218	0.060	RP3A_RAT Rabphilin-3A OS=Rattus norvegicus OX=10116 GN=Rph3a PE=1 SV=1
18	Q768S5	5.95e-13	68.6	681	0.218	0.060	Q768S5_MOUSE Rabphilin OS=Mus musculus OX=10090 GN=Rph3a PE=2 SV=1
19	Q95QH7	6.39e-13	68.2	443	0.239	0.102	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
20	Q920N7	1.03e-12	67.4	421	0.234	0.105	SYT12_MOUSE Synaptotagmin-12 OS=Mus musculus OX=10090 GN=Syt12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	4e-09	48.1	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003810489.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003810612.1	0.660	Belongs to the SNAP-25 family.
2	9597.XP_003832837.1	0.630	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 378 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
3	9597.XP_003805647.1	0.605	Belongs to the SNAP-25 family.
4	9597.XP_008969562.1	0.568	Vesicle associated membrane protein 2
5	9597.XP_003809872.1	0.562	Cytidine and dCMP deaminase domain containing 1
6	9597.XP_008967649.1	0.555	Extended synaptotagmin-2
7	9597.XP_008973452.1	0.547	Regulating synaptic membrane exocytosis protein 2 isoform X1
8	9597.XP_008961967.1	0.546	Complexin 1
9	9597.XP_003814986.1	0.545	Synaptosome associated protein 47
10	9597.XP_008954223.1	0.540	Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.
11	9597.XP_003814259.1	0.539	SERTA domain containing 4
12	9597.XP_008966773.1	0.534	Belongs to the syntaxin family.
13	9597.XP_008956784.1	0.532	Synaptosomal-associated protein 29
14	9597.XP_003829874.1	0.530	Unc-13 homolog B
15	9597.XP_008971984.1	0.521	Vesicle associated membrane protein 1
16	9597.XP_008968169.1	0.510	Rab effector Noc2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.956	lipid binding
GO:0005543	0.930	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0023056	0.986	positive regulation of signaling
GO:0010647	0.986	positive regulation of cell communication
GO:0051128	0.984	regulation of cellular component organization
GO:0009966	0.967	regulation of signal transduction
GO:0009967	0.945	positive regulation of signal transduction
GO:1903859	0.936	regulation of dendrite extension
GO:0045927	0.894	positive regulation of growth
GO:0048639	0.839	positive regulation of developmental growth
GO:0030307	0.829	positive regulation of cell growth
GO:0019222	0.777	regulation of metabolic process
GO:0060255	0.771	regulation of macromolecule metabolic process
GO:0010468	0.763	regulation of gene expression
GO:1902533	0.758	positive regulation of intracellular signal transduction
GO:0043408	0.746	regulation of MAPK cascade
GO:0031323	0.725	regulation of cellular metabolic process
GO:0070372	0.725	regulation of ERK1 and ERK2 cascade
GO:0065009	0.716	regulation of molecular function
GO:0006355	0.715	regulation of DNA-templated transcription
GO:0051090	0.622	regulation of DNA-binding transcription factor activity
GO:0043410	0.620	positive regulation of MAPK cascade
GO:0051091	0.606	positive regulation of DNA-binding transcription factor activity
GO:0070374	0.579	positive regulation of ERK1 and ERK2 cascade
GO:0051234	0.407	establishment of localization
GO:0009987	0.387	cellular process
GO:0006810	0.387	transport
GO:0051641	0.359	cellular localization
GO:0016192	0.353	vesicle-mediated transport
GO:0065008	0.312	regulation of biological quality
GO:0006887	0.311	exocytosis
GO:0051049	0.309	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005622	0.995	intracellular anatomical structure
GO:0043227	0.985	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0031982	0.970	vesicle
GO:0005737	0.956	cytoplasm
GO:0005886	0.945	plasma membrane
GO:0042995	0.912	cell projection
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0120025	0.881	plasma membrane bounded cell projection
GO:0030054	0.584	cell junction
GO:0045202	0.572	synapse
GO:0097708	0.559	intracellular vesicle
GO:0012505	0.519	endomembrane system
GO:0031410	0.509	cytoplasmic vesicle
GO:0032991	0.377	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]