StarFunc result for job id Q5BKX6

User Input

>input (768 residues)
MKMAPQNADPESMQVQELSVPLPDPQKAGGAEAENCETISEGSIDRIPMRLWVMHGAVMF
GREFCYAMETALVTPILLQIGLPEQYYSLTWFLSPILGLIFTPLIGSASDRCTLSWGRRR
PFILALCVGVLFGVALFLNGSAIGLALGDVPNRQPIGIVLTVLGVVVLDFSADATEGPIR
AYLLDVVDSEEQDMALNIHAFSAGLGGAIGYVLGGLDWTQTFLGSWFRTQNQVLFFFAAI
IFTVSVALHLFSIDEEQYSPQQERSAEEPGALDGGEPHGVPAFPDEVQSEHELALDYPDV
DIMRSKSDSALHVPDTALDLEPELLFLHDIEPSIFHDASYPATPRSTSQELAKTKLPRLA
TFLKEAAKEDETLLDNHLNEAKVPNGSGSPTKDALGGYTRVDTKPSATSSSMRRRRHAFR
RQASSTFSYYGKLGSHCYRYRRANAVVLIKPSRSMSDLYDMQKRQRQHRHRNQSGATTSS
GDTESEEGEGETTVRLLWLSMLKMPRELMRLCLCHLLTWFSVIAEAVFYTDFMGQVIFEG
DPKAPSNSTAWQAYNAGVKMGCWGLVIYAATGAICSALLQKYLDNYDLSVRVIYVLGTLG
FSVGTAVMAMFPNVYVAMVTISTMGIVSMSISYCPYALLGQYHDIKQYIHHSPGNSKRGF
GIDCAILSCQVYISQILVASALGGVVDAVGTVRVIPMVASVGSFLGFLTATFLVIYPNVS
EEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKLTRKEGLQGPVETESVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8WG95	0.556	0.766	7.197E-33	554	0.263	0.365	A8WG95.pdb.gz	A8WG95_DANRE Membrane-associated transporter protein OS=Danio rerio OX=7955 GN=aim1 PE=2 SV=1
2	AFDB:Q9UMX9	0.566	0.811	1.361E-32	530	0.259	0.375	Q9UMX9.pdb.gz	S45A2_HUMAN Membrane-associated transporter protein OS=Homo sapiens OX=9606 GN=SLC45A2 PE=1 SV=2
3	AFDB:P58355	0.564	0.809	1.079E-31	530	0.263	0.381	P58355.pdb.gz	S45A2_MOUSE Membrane-associated transporter protein OS=Mus musculus OX=10090 GN=Slc45a2 PE=1 SV=1
4	PDB:6thaA	0.389	0.617	2.273E-7	448	0.095	0.163	6thaA.pdb.gz
5	PDB:7sptA	0.425	0.658	5.680E-7	470	0.086	0.140	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
6	PDB:7oixB	0.431	0.692	1.118E-6	451	0.095	0.162	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
7	PDB:7n98A	0.441	0.680	1.310E-6	473	0.095	0.154	7n98A.pdb.gz
8	PDB:4gbyA	0.439	0.670	1.537E-6	475	0.087	0.141	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
9	PDB:7wsmA	0.404	0.619	2.113E-6	464	0.090	0.149	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
10	PDB:7bc7A	0.388	0.653	3.713E-5	432	0.087	0.155	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
11	PDB:4ybqB	0.396	0.608	5.313E-5	462	0.074	0.123	4ybqB.pdb.gz
12	PDB:3o7qA	0.391	0.670	6.747E-5	414	0.086	0.159	3o7qA.pdb.gz
13	PDB:7aaqA	0.383	0.563	1.045E-4	487	0.077	0.121	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
14	AFDB:P23900	0.064	0.070	1.031E-1	669	0.100	0.115	P23900.pdb.gz	FPS1_YEAST Glycerol uptake/efflux facilitator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPS1 PE=1 SV=2
15	AFDB:A0A0N4SWF5	0.076	0.076	2.575E-1	770	0.098	0.097	A0A0N4SWF5.pdb.gz	A0A0N4SWF5_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
16	AFDB:Q6FWS6	0.083	0.093	4.321E-1	652	0.094	0.110	Q6FWS6.pdb.gz	Q6FWS6_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=FPS1 PE=4 SV=1
17	AFDB:A7MBM2	0.091	0.059	6.183E-1	1401	0.078	0.043	A7MBM2.pdb.gz	DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens OX=9606 GN=DISP2 PE=2 SV=2
18	AFDB:E9Q6H8	0.051	0.035	7.250E-1	1269	0.100	0.061	E9Q6H8.pdb.gz	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
19	AFDB:Q5I012	0.088	0.067	1.317	1090	0.107	0.075	Q5I012.pdb.gz	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2
20	AFDB:O94294	0.080	0.072	1.484	886	0.105	0.091	O94294.pdb.gz	SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sog2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0P5V9	0.0	1267	785	0.862	0.843	S45A4_MOUSE Solute carrier family 45 member 4 OS=Mus musculus OX=10090 GN=Slc45a4 PE=1 SV=1
2	P58355	3.82e-64	225	530	0.148	0.215	S45A2_MOUSE Membrane-associated transporter protein OS=Mus musculus OX=10090 GN=Slc45a2 PE=1 SV=1
3	Q9UMX9	2.18e-63	223	530	0.137	0.198	S45A2_HUMAN Membrane-associated transporter protein OS=Homo sapiens OX=9606 GN=SLC45A2 PE=1 SV=2
4	A8WG95	2.21e-62	221	554	0.134	0.186	A8WG95_DANRE Membrane-associated transporter protein OS=Danio rerio OX=7955 GN=aim1 PE=2 SV=1
5	Q8BIV7	9.51e-53	197	751	0.129	0.132	S45A1_MOUSE Proton-associated sugar transporter A OS=Mus musculus OX=10090 GN=Slc45a1 PE=1 SV=3
6	Q9Y2W3	5.83e-52	196	782	0.130	0.128	S45A1_HUMAN Proton-associated sugar transporter A OS=Homo sapiens OX=9606 GN=SLC45A1 PE=1 SV=5
7	Q8K4S3	6.97e-52	195	751	0.129	0.132	S45A1_RAT Proton-associated sugar transporter A OS=Rattus norvegicus OX=10116 GN=Slc45a1 PE=1 SV=1
8	A0A0S0WGX2	8.33e-45	172	615	0.126	0.158	A0A0S0WGX2_DROME Loss of visual transmission OS=Drosophila melanogaster OX=7227 GN=lovit PE=4 SV=1
9	Q9VSV1	3.83e-42	164	599	0.116	0.149	Q9VSV1_DROME LP09277p OS=Drosophila melanogaster OX=7227 GN=Slc45-1 PE=2 SV=1
10	Q8K0H7	4.08e-32	134	553	0.100	0.139	S45A3_MOUSE Solute carrier family 45 member 3 OS=Mus musculus OX=10090 GN=Slc45a3 PE=1 SV=1
11	Q96JT2	1.55e-31	132	553	0.104	0.145	S45A3_HUMAN Solute carrier family 45 member 3 OS=Homo sapiens OX=9606 GN=SLC45A3 PE=2 SV=1
12	Q9FE59	4.02e-24	109	510	0.079	0.120	SUC4_ARATH Sucrose transport protein SUC4 OS=Arabidopsis thaliana OX=3702 GN=SUC4 PE=1 SV=2
13	Q39231	1.41e-22	104	512	0.111	0.166	SUC2_ARATH Sucrose transport protein SUC2 OS=Arabidopsis thaliana OX=3702 GN=SUC2 PE=1 SV=2
14	Q39232	3.82e-22	103	513	0.094	0.140	SUC1_ARATH Sucrose transport protein SUC1 OS=Arabidopsis thaliana OX=3702 GN=SUC1 PE=1 SV=1
15	Q9C8X2	9.62e-22	102	512	0.091	0.137	SUC5_ARATH Sucrose transport protein SUC5 OS=Arabidopsis thaliana OX=3702 GN=SUC5 PE=1 SV=1
16	Q10R54	1.33e-20	98.6	538	0.074	0.106	SUT1_ORYSJ Sucrose transport protein SUT1 OS=Oryza sativa subsp. japonica OX=39947 GN=SUT1 PE=1 SV=1
17	Q69JW3	1.39e-19	95.5	535	0.090	0.129	SUT5_ORYSJ Sucrose transport protein SUT5 OS=Oryza sativa subsp. japonica OX=39947 GN=SUT5 PE=1 SV=1
18	Q9FG00	1.97e-19	94.7	491	0.081	0.126	SUC9_ARATH Sucrose transport protein SUC9 OS=Arabidopsis thaliana OX=3702 GN=SUC9 PE=1 SV=1
19	O80605	1.58e-17	89.4	594	0.066	0.086	SUC3_ARATH Sucrose transport protein SUC3 OS=Arabidopsis thaliana OX=3702 GN=SUC3 PE=1 SV=1
20	Q0ILJ3	2.30e-16	85.1	501	0.076	0.116	SUT2_ORYSJ Sucrose transport protein SUT2 OS=Oryza sativa subsp. japonica OX=39947 GN=SUT2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13347 MFS_2	0.00027	31.3	MFS/sugar transport protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428137

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358820	0.721	Epidermal growth factor receptor kinase substrate 8-like protein 3
2	9606.ENSP00000295317	0.718	E3 ubiquitin-protein ligase RNF149
3	9606.ENSP00000305302	0.695	Sodium-dependent neutral amino acid transporter B(0)AT1
4	9606.ENSP00000388550	0.686	RING finger protein 24
5	9606.ENSP00000439068	0.613	Death domain-containing protein CRADD
6	9606.ENSP00000347665	0.594	Collagen alpha-1(XVIII) chain
7	9606.ENSP00000360855	0.547	Monocarboxylate transporter 12
8	9606.ENSP00000319991	0.539	Monocarboxylate transporter 7
9	9606.ENSP00000302851	0.538	Solute carrier family 23 member 1
10	9606.ENSP00000365413	0.527	Solute carrier family 28 member 3
11	9606.ENSP00000264399	0.522	cGMP-dependent protein kinase 2
12	9606.ENSP00000480890	0.512	Sodium- and chloride-dependent taurine transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008515	1.000	sucrose transmembrane transporter activity
GO:0005351	1.000	carbohydrate:proton symporter activity
GO:0005515	0.995	protein binding
GO:0051119	0.932	sugar transmembrane transporter activity
GO:0015145	0.865	monosaccharide transmembrane transporter activity
GO:0015149	0.830	hexose transmembrane transporter activity
GO:0005355	0.823	glucose transmembrane transporter activity
GO:0008506	0.681	sucrose:proton symporter activity
GO:0005356	0.356	glucose:proton symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071702	0.965	organic substance transport
GO:0008643	0.926	carbohydrate transport
GO:0009987	0.862	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0005886	0.965	plasma membrane
GO:0031982	0.856	vesicle
GO:0031410	0.636	cytoplasmic vesicle
GO:0012505	0.513	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]