StarFunc result for job id Q5CZC0

User Input

>input (1400 residues)
MELYLGACSKPAKVAVTKTVASVLAADTQQCRDGVHKTHFAGVGPAQLLDLPLGVKLPVI
PGSNAVFYTTNFGEKLFRPSYGFNLTDPYCRLLENQYKSLHDPHLKAYYKRKDILKRLKK
GGYITSNNKVVCTLRELNKYRQYLTSLKLDFERNYIKEQRILAKQLHNIPENNQIPQHCD
VAQVQNWLLKEGTESIKDQERLMRHRYLDMISRKLEQLERTAEEQRLFLMDREERRQREH
TRRKLTLRRKIEEEWKTKEMLLLTRMAEDVKREERIEEQQHRNREESDRKKQDLLEKKMA
YHLQKMQDTGFNGEDIGKNTFKYRGQDGTHASPKNKKKTSEDIMLVYPAGDQNTYKETHG
HTANAAHQRQNSSNNFTKKNSASVVYQADVQDNGINQKRDGMVSKNSSIFDDRGGINISG
QGSIISAQVSPTRNFSRVSQAFLDPSKEEKETNADWDGRPTKRSSYLCESGPQAHATDPG
IFSSPVYTNMQQNLLQNCLQEKVTSEELNIIIQNVMTWVVATVTSILYPAITKYEKRLQN
NTYPVSDDSILSSDSSSFCSTCSEDFTYRSYTSATTKTFQAEPCAFVVDTSVRRPTTPIK
PPPAHVEKTVVGKTCHIKGQSIISKHKYNKTNLLYSYPKLRSCKSDSHLLASFETGTKKS
KDATTETDSLGSSLHCDKTAKAMDEMKNLKNVFVNFKCYLKGETEVILESILREIMSDLT
QAIPSLSSVTAEVFVEQCEREKEILLSNAHIPSVASEIVENMLEKLESAVEKKCVEMFSQ
DLSVDIKPSLAASDELLTSSNGKPLKNSMPHTLDPMCDIAEDMVHAILEKLMTLVSFKQN
EFLHLKDTNKLSCQQHKTDPICMFLQRAGKNKSSLESDEASLIVNEEVQNLISNIFSQSS
LVAYIEEAINAILGYIQTELNNERIIASEETVVLLQLLEDILFQLHQEPVNESFQKSRQP
RISSPSDTKEKYRLTGTRLSNSPRSGRPFPPINVPGMVLYSDDENEEIDNIVKNVLDSTF
KDEKVKSQEQIPNHWFTKGNTCFECKRNIKPPTKPGSRSKAAFHDWELKTEPPSTNHEDI
LKKKLSSNKDISTFSQDQKHQIEKASENIVTSILKEMLKDISSVPFGHLDSKTGSEASVL
VSEKPQGLSHQEWIDQMFSVSEISTVAQEITDSVLNILHKASNYISNTTKSSISSSVHQI
SLHNSDTEHIVKEAPNKYPLKTWFDSEKKMKYLSLFDVDPEKPPWLKSGKSEPKPVDDIN
DKIIRTIFKRLKSFICPKLHMGFKSSLRSQLSKYTAKIVNIVLCAIQNELELHKENLNLR
EIDHTKSLTDKGFFANTDKKLESLVTSIDDDILASPLLTCIYDMLLSSENAHQRSISLSS
RKPKSATDSVDVQSILPNRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VGN4	0.043	0.051	6.953E-5	935	0.086	0.129	Q9VGN4.pdb.gz	Q9VGN4_DROME Sarcomere length short, isoform B OS=Drosophila melanogaster OX=7227 GN=sals PE=1 SV=2
2	AFDB:Q62924	0.053	0.062	2.772E-4	1129	0.109	0.136	Q62924.pdb.gz	AKA11_RAT A-kinase anchor protein 11 OS=Rattus norvegicus OX=10116 GN=Akap11 PE=1 SV=1
3	AFDB:O00268	0.039	0.048	1.296E-3	1085	0.089	0.115	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
4	AFDB:Q0E8J0	0.039	0.041	1.691E-3	1152	0.086	0.105	Q0E8J0.pdb.gz	Q0E8J0_DROME MEP-1, isoform A OS=Drosophila melanogaster OX=7227 GN=MEP-1 PE=1 SV=1
5	AFDB:Q583Y9	0.038	0.055	2.327E-3	933	0.077	0.116	Q583Y9.pdb.gz	Q583Y9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.600 PE=4 SV=1
6	AFDB:Q38EZ3	0.039	0.040	2.454E-3	1346	0.103	0.107	Q38EZ3.pdb.gz	Q38EZ3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4120 PE=4 SV=1
7	AFDB:Q9W539	0.039	0.037	2.588E-3	1518	0.094	0.086	Q9W539.pdb.gz	HR4_DROME Hormone receptor 4 OS=Drosophila melanogaster OX=7227 GN=Hr4 PE=1 SV=4
8	AFDB:Q9LNC4	0.035	0.056	3.561E-3	766	0.066	0.121	Q9LNC4.pdb.gz	GTE4_ARATH Transcription factor GTE4 OS=Arabidopsis thaliana OX=3702 GN=GTE4 PE=2 SV=1
9	AFDB:B2RX88	0.041	0.045	4.900E-3	1205	0.109	0.126	B2RX88.pdb.gz	CSPP1_MOUSE Centrosome and spindle pole associated protein 1 OS=Mus musculus OX=10090 GN=Cspp1 PE=1 SV=2
10	AFDB:Q7YSI9	0.043	0.038	6.742E-3	1654	0.092	0.078	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
11	PDB:3javA	0.042	0.030	1.565	2327	0.084	0.051	3javA.pdb.gz
12	PDB:6q0xA	0.036	0.109	1.651	373	0.023	0.086	6q0xA.pdb.gz
13	PDB:3j6bT	0.033	0.152	2.153	209	0.016	0.110	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
14	PDB:3hajA	0.037	0.139	2.395	286	0.025	0.122	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
15	PDB:7ungA3	0.036	0.117	2.395	333	0.026	0.108	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7ah91A	0.035	0.128	3.476	223	0.018	0.112	7ah91A.pdb.gz
17	PDB:7sqkE	0.040	0.078	4.300	610	0.027	0.062	7sqkE.pdb.gz
18	PDB:7r0cA	0.041	0.148	5.319	284	0.029	0.144	7r0cA.pdb.gz	Structure of the vasopressin hormone-V2 receptor-beta-arrestin1 ternary complex.
19	PDB:7rroA3	0.041	0.129	5.319	334	0.023	0.096	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:5x3xQ	0.035	0.127	5.610	243	0.009	0.053	5x3xQ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ARZ3	0.0	1636	6995	0.634	0.127	FSIP2_MOUSE Fibrous sheath-interacting protein 2 OS=Mus musculus OX=10090 GN=Fsip2 PE=1 SV=3
2	Q5CZC0	0.0	2927	6907	1.000	0.203	FSIP2_HUMAN Fibrous sheath-interacting protein 2 OS=Homo sapiens OX=9606 GN=FSIP2 PE=2 SV=4
3	Q9KS12	0.027	41.6	4558	0.024	0.007	MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=rtxA PE=1 SV=2
4	M9PC41	0.032	41.6	22743	0.052	0.003	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PB30	0.035	41.2	22949	0.052	0.003	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
6	M9PBZ0	0.035	41.2	22830	0.052	0.003	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PC45	0.037	41.2	22300	0.052	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PEI1	0.039	41.2	21657	0.052	0.003	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PB32	0.042	41.2	19560	0.052	0.004	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PEH5	0.043	41.2	20710	0.052	0.004	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PBZ4	0.054	40.8	18014	0.052	0.004	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PB31	0.055	40.8	20404	0.052	0.004	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9NCR4	0.067	40.4	15105	0.052	0.005	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9NER8	0.070	40.4	15638	0.052	0.005	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PCJ8	0.070	40.4	14825	0.052	0.005	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	F4J0L7	0.077	40.0	2156	0.021	0.013	F4J0L7_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At3g50370 PE=1 SV=1
17	Q6DKI1	0.29	37.4	255	0.011	0.063	RL7L_HUMAN Ribosomal protein uL30-like OS=Homo sapiens OX=9606 GN=RPL7L1 PE=1 SV=2
18	O35889	1.1	36.2	1829	0.019	0.014	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
19	Q04047	1.6	35.8	700	0.024	0.047	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
20	E9PKI6	2.9	34.7	752	0.011	0.021	E9PKI6_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280236	0.823	Fibrous sheath interacting protein 1
2	9606.ENSP00000351327	0.800	A-kinase anchor protein 4
3	9606.ENSP00000228850	0.743	A-kinase anchor protein 3
4	9606.ENSP00000311030	0.708	Multidrug resistance-associated protein 9
5	9606.ENSP00000349568	0.698	Cilia and flagella associated protein 43
6	9606.ENSP00000373948	0.651	Cilia- and flagella-associated protein 69
7	9606.ENSP00000377428	0.640	Cilia and flagella associated protein 44
8	9606.ENSP00000262225	0.615	Transmembrane emp24 domain-containing protein 2
9	9606.ENSP00000288912	0.611	Cilia- and flagella-associated protein 251
10	9606.ENSP00000357660	0.611	Clarin-3
11	9606.ENSP00000334474	0.610	Zinc finger MIZ domain-containing protein 1
12	9606.ENSP00000465260	0.610	Voltage-dependent calcium channel beta subunit-associated regulatory protein
13	9606.ENSP00000378230	0.604	ATP-binding cassette sub-family C member 11
14	9606.ENSP00000448228	0.594	Spermatogenesis-associated serine-rich protein 2
15	9606.ENSP00000376417	0.575	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).
16	9606.ENSP00000321338	0.546	Olfactory receptor 4C5
17	9606.ENSP00000361207	0.545	Growth hormone-inducible transmembrane protein
18	9606.ENSP00000401514	0.537	Dynein heavy chain 1, axonemal
19	9606.ENSP00000262765	0.522	Glutamine-rich protein 2
20	9606.ENSP00000320232	0.517	Coiled-coil domain containing 168

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0070925	0.981	organelle assembly
GO:0007010	0.977	cytoskeleton organization
GO:0030317	0.946	flagellated sperm motility
GO:0060271	0.936	cilium assembly
GO:0007286	0.935	spermatid development
GO:0035082	0.934	axoneme assembly
GO:0120316	0.934	sperm flagellum assembly
GO:0007288	0.906	sperm axoneme assembly
GO:0033365	0.859	protein localization to organelle
GO:0061512	0.729	protein localization to cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031514	1.000	motile cilium
GO:0097729	0.744	9+2 motile cilium
GO:0036126	0.720	sperm flagellum
GO:0005622	0.709	intracellular anatomical structure
GO:0097228	0.655	sperm principal piece
GO:0043229	0.617	intracellular organelle
GO:0097225	0.611	sperm midpiece
GO:0043231	0.452	intracellular membrane-bounded organelle
GO:0005737	0.385	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]