StarFunc result for job id Q5D1E8

User Input

>input (599 residues)
MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGY
SSTEIHSVLQKLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPN
LEPPLPEEEKEGSDLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVP
SWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAYESDGIV
VSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLTLE
HRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSP
SSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPA
TAAFSAFGRAMGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGR
SPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5D1E8	1.000	1.000	3.375E-100	599	1.000	1.000	Q5D1E8.pdb.gz	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
2	AFDB:Q5D1E7	0.571	0.574	4.623E-86	596	0.823	0.827	Q5D1E7.pdb.gz	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
3	AFDB:Q9C0D7	0.299	0.207	2.840E-50	883	0.494	0.335	Q9C0D7.pdb.gz	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
4	AFDB:Q8BIY3	0.320	0.357	9.809E-41	533	0.357	0.402	Q8BIY3.pdb.gz	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
5	PDB:5dizA	0.190	0.237	2.161E-5	474	0.048	0.061	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.
6	PDB:7onuE	0.190	0.239	6.023E-4	467	0.045	0.058	7onuE.pdb.gz	Structural basis of RNA processing by human mitochondrial RNase P.
7	PDB:7mq8SL	0.125	0.307	2.013E-2	192	0.050	0.156	7mq8SL.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:3ivtB	0.101	0.131	2.724E-2	400	0.040	0.060	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
9	PDB:7d5s5K	0.144	0.389	4.161E-2	175	0.047	0.160	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
10	AFDB:O88735	0.066	0.057	4.973E-2	730	0.164	0.134	O88735.pdb.gz	MAP7_MOUSE Ensconsin OS=Mus musculus OX=10090 GN=Map7 PE=1 SV=1
11	AFDB:D3DQV9	0.092	0.066	1.233E-1	907	0.150	0.099	D3DQV9.pdb.gz	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
12	PDB:4f4jA	0.079	0.191	1.575E-1	189	0.040	0.127	4f4jA.pdb.gz
13	PDB:7dlwB	0.113	0.148	1.777E-1	419	0.028	0.041	7dlwB.pdb.gz	Dual activities of ACC synthase: Novel clues regarding the molecular evolution of ACS genes.
14	AFDB:Q8R1W8	0.091	0.073	2.125E-1	798	0.110	0.083	Q8R1W8.pdb.gz	IMPG1_MOUSE Interphotoreceptor matrix proteoglycan 1 OS=Mus musculus OX=10090 GN=Impg1 PE=1 SV=1
15	PDB:6a7vC	0.110	0.374	2.264E-1	139	0.032	0.137	6a7vC.pdb.gz
16	AFDB:A0A0G2KB52	0.060	0.051	2.398E-1	751	0.159	0.126	A0A0G2KB52.pdb.gz	A0A0G2KB52_RAT Microtubule-associated protein 7 OS=Rattus norvegicus OX=10116 GN=Map7 PE=1 SV=2
17	PDB:4gskB	0.126	0.130	2.555E-1	572	0.035	0.037	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
18	AFDB:E7FH23	0.053	0.042	3.054E-1	859	0.080	0.056	E7FH23.pdb.gz	E7FH23_DANRE Actin filament-associated protein 1-like 2 OS=Danio rerio OX=7955 GN=afap1l2 PE=4 SV=1
19	AFDB:Q80T85	0.054	0.037	3.245E-1	946	0.150	0.095	Q80T85.pdb.gz	DCAF5_MOUSE DDB1- and CUL4-associated factor 5 OS=Mus musculus OX=10090 GN=Dcaf5 PE=1 SV=2
20	PDB:5e0oA	0.086	0.116	3.903E-1	418	0.037	0.053	5e0oA.pdb.gz	Structure of the trehalose-6-phosphate phosphatase from Brugia malayi reveals key design principles for anthelmintic drugs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5D1E7	0.0	949	596	0.823	0.827	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
2	Q5D1E8	0.0	1217	599	1.000	1.000	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
3	Q9C0D7	1.01e-137	424	883	0.349	0.237	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
4	A2A288	1.09e-117	361	527	0.316	0.359	ZC12D_HUMAN Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3
5	Q8BIY3	4.22e-117	360	533	0.304	0.341	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
6	O15037	8.82e-51	188	678	0.152	0.134	KHNYN_HUMAN Protein KHNYN OS=Homo sapiens OX=9606 GN=KHNYN PE=1 SV=3
7	Q6A037	2.29e-49	186	893	0.145	0.097	N4BP1_MOUSE NEDD4-binding protein 1 OS=Mus musculus OX=10090 GN=N4bp1 PE=1 SV=2
8	O75113	2.28e-48	183	896	0.139	0.093	N4BP1_HUMAN NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4
9	B7ZBA4	2.43e-36	135	167	0.132	0.473	B7ZBA4_HUMAN Zinc finger CCCH-type containing 12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1
10	G5EBN5	1.7	34.3	1492	0.050	0.020	G5EBN5_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
11	H8ESG1	1.8	34.3	1494	0.050	0.020	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
12	Q584Y9	2.9	31.2	102	0.028	0.167	Q584Y9_TRYB2 Zinc finger protein ZFP1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.250 PE=4 SV=1
13	Q9V3H9	3.2	33.5	1004	0.015	0.009	Q9V3H9_DROME Zinc finger CCCH domain-containing protein 14 OS=Drosophila melanogaster OX=7227 GN=Nab2 PE=1 SV=1
14	F4IUS5	4.9	32.3	457	0.052	0.068	F4IUS5_ARATH Zinc finger nuclease 2 OS=Arabidopsis thaliana OX=3702 GN=ZFN2 PE=1 SV=2
15	Q9QXP6	7.2	32.0	481	0.023	0.029	MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus OX=10090 GN=Mkrn1 PE=1 SV=1
16	F4JVH1	8.8	32.0	907	0.035	0.023	CFM3B_ARATH CRM-domain containing factor CFM3B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CFM3B PE=1 SV=1
17	Q23342	9.6	31.6	339	0.057	0.100	Q23342_CAEEL RNase NYN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rde-8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18561 Regnase_1_C	1e-19	81.3	Endoribonuclease Regnase 1/ ZC3H12 C-terminal domain
2	PF11977 RNase_Zc3h12a	7e-64	225.7	Zc3h12a-like Ribonuclease NYN domain
3	PF18039 UBA_6	1.1e-15	68.7	UBA-like domain
4	PF14608 zf-CCCH_2	2.8e+02	13.5	RNA-binding, Nab2-type zinc finger
5	PF18044 zf-CCCH_4	97	14.2	CCCH-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376505	0.990	TRAF family member-associated NF-kappa-B activator
2	9606.ENSP00000303206	0.770	Lithostathine-1-beta
3	9606.ENSP00000233735	0.768	Lithostathine-1-alpha
4	9606.ENSP00000401980	0.765	Mitochondrial antiviral-signaling protein
5	9606.ENSP00000470142	0.745	Regulator of nonsense transcripts 1
6	9606.ENSP00000356669	0.734	Roquin-1
7	9606.ENSP00000261658	0.732	Bifunctional apoptosis regulator
8	9606.ENSP00000325663	0.730	NF-kappa-B inhibitor zeta
9	9606.ENSP00000433623	0.730	TNF receptor-associated factor 6
10	9606.ENSP00000362774	0.676	Roquin-2
11	9606.ENSP00000263341	0.674	Interleukin-1 beta
12	9606.ENSP00000385675	0.668	Interleukin-6
13	9606.ENSP00000296015	0.664	Belongs to the TTC14 family
14	9606.ENSP00000350078	0.664	AT-rich interactive domain-containing protein 5A
15	9606.ENSP00000379144	0.661	Trinucleotide repeat-containing gene 6A protein
16	9606.ENSP00000483825	0.661	NF-kappa-B essential modulator
17	9606.ENSP00000386869	0.654	Methylcytosine dioxygenase TET3
18	9606.ENSP00000481570	0.645	Tumor necrosis factor alpha-induced protein 3
19	9606.ENSP00000457411	0.641	Ubiquitin carboxyl-terminal hydrolase 10
20	9606.ENSP00000380109	0.632	NF-kappa-B inhibitor delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003729	0.999	mRNA binding
GO:0004540	0.999	ribonuclease activity
GO:0140096	0.967	catalytic activity, acting on a protein
GO:0101005	0.909	deubiquitinase activity
GO:0004843	0.903	cysteine-type deubiquitinase activity
GO:0061980	0.884	regulatory RNA binding
GO:0035198	0.872	miRNA binding
GO:0003682	0.869	chromatin binding
GO:0003677	0.862	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048518	0.991	positive regulation of biological process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0031323	0.990	regulation of cellular metabolic process
GO:0010629	0.987	negative regulation of gene expression
GO:0071704	0.986	organic substance metabolic process
GO:0043122	0.985	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051716	0.981	cellular response to stimulus
GO:0044238	0.980	primary metabolic process
GO:0051248	0.980	negative regulation of protein metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0009894	0.977	regulation of catabolic process
GO:0031325	0.977	positive regulation of cellular metabolic process
GO:0010608	0.976	post-transcriptional regulation of gene expression
GO:1903311	0.976	regulation of mRNA metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0009057	0.971	macromolecule catabolic process
GO:0031331	0.971	positive regulation of cellular catabolic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0034655	0.971	nucleobase-containing compound catabolic process
GO:0061013	0.970	regulation of mRNA catabolic process
GO:0071345	0.969	cellular response to cytokine stimulus
GO:0017148	0.968	negative regulation of translation
GO:0051173	0.965	positive regulation of nitrogen compound metabolic process
GO:0010604	0.965	positive regulation of macromolecule metabolic process
GO:0033554	0.964	cellular response to stress
GO:0002684	0.957	positive regulation of immune system process
GO:0001817	0.957	regulation of cytokine production
GO:0043487	0.957	regulation of RNA stability
GO:0051254	0.957	positive regulation of RNA metabolic process
GO:0050776	0.955	regulation of immune response
GO:0061014	0.953	positive regulation of mRNA catabolic process
GO:0043488	0.952	regulation of mRNA stability
GO:0032101	0.950	regulation of response to external stimulus
GO:0006401	0.949	RNA catabolic process
GO:0002376	0.948	immune system process
GO:0001818	0.943	negative regulation of cytokine production
GO:0023052	0.940	signaling
GO:0007154	0.940	cell communication
GO:0048584	0.937	positive regulation of response to stimulus
GO:0010941	0.934	regulation of cell death
GO:0051090	0.925	regulation of DNA-binding transcription factor activity
GO:0050779	0.923	RNA destabilization
GO:0051707	0.921	response to other organism
GO:0002683	0.920	negative regulation of immune system process
GO:0031399	0.913	regulation of protein modification process
GO:0007165	0.909	signal transduction
GO:0002695	0.909	negative regulation of leukocyte activation
GO:0050793	0.898	regulation of developmental process
GO:0051249	0.890	regulation of lymphocyte activation
GO:1901700	0.882	response to oxygen-containing compound
GO:0061157	0.882	mRNA destabilization
GO:0010628	0.873	positive regulation of gene expression
GO:0031328	0.871	positive regulation of cellular biosynthetic process
GO:1902533	0.870	positive regulation of intracellular signal transduction
GO:0010557	0.858	positive regulation of macromolecule biosynthetic process
GO:0045595	0.849	regulation of cell differentiation
GO:0080134	0.843	regulation of response to stress
GO:0031347	0.818	regulation of defense response
GO:0043067	0.787	regulation of programmed cell death
GO:0019538	0.782	protein metabolic process
GO:0043412	0.718	macromolecule modification
GO:0006357	0.678	regulation of transcription by RNA polymerase II
GO:0036211	0.671	protein modification process
GO:0051247	0.593	positive regulation of protein metabolic process
GO:1903508	0.559	positive regulation of nucleic acid-templated transcription
GO:0042981	0.468	regulation of apoptotic process
GO:0071840	0.321	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0016020	0.959	membrane
GO:0005829	0.945	cytosol
GO:0099080	0.755	supramolecular complex
GO:0005856	0.737	cytoskeleton
GO:0012505	0.708	endomembrane system
GO:0035770	0.687	ribonucleoprotein granule
GO:0036464	0.680	cytoplasmic ribonucleoprotein granule
GO:0000932	0.412	P-body
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.999	Acting on ester bonds.
EC:3.4.-.-	0.909	Acting on peptide bonds (peptidases).
EC:3.4.19.12	0.903	ubiquitinyl hydrolase 1.

[back to server]