StarFunc result for job id Q5DID0

User Input

>input (1318 residues)
MLRTSGLALLALVSAVGPSQASGFTEKGLSLLGYQLCSHRVTHTVQKVEAVQTSYTSYVS
CGGWIPWRRCPKMVYRTQYLVVEVPESRNVTDCCEGYEQLGLYCVLPLNQSGQFTSRPGA
CPAEGPEPSTSPCSLDIDCPGLEKCCPWSGGRYCMAPAPQAPERDPVGSWYNVTILVKMD
FKELQQVDPRLLNHMRLLHSLVTSALQPMASTVHHLHSAPGNASTTVSRLLLGLPRPLPV
ADVSTLLGDIAKRVYEVISVQVQDVNECFYEELNACSGRELCANLEGSYWCVCHQEAPAT
SPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRSARTQS
QALAVAGLEAGVLYRVKTSYQGCGADVSTTLTIKTNAQVFEVTIKIVNHNLTEKLLNRSS
VEYQDFSRQLLHEVESSFPPVVSDLYRSGKLRMQIVSLQAGSVVVRLKLTVQDPGFPMGI
STLAPILQPLLASTVFQIDRQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTR
DATPSRAGRACEGDLVSPMGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPA
AGQAWTPEPSPRRGGSNVVGYDRNNTGKGVEQELQGNSIMEPPSWPSPTEDPTGHFLWHA
TRSTRETLLNPTWLRNEDSGPSGSVDLPLTSTLTALKTPACVPVSIGRIMVSNVTSTGFH
LAWEADLAMDSTFQLTLTSMWSPAVVLETWNTSVTLSGLEPGVLHLVEIMAKACGKEGAR
AHLKVRTAARKLIGKVRIKNVRYSESFRNASSQEYRDFLELFFRMVRGSLPATMCQHMDA
GGVRMEVVSVTNGSIVVEFHLLIIADVDVQEVSAAFLTAFQTVPLLEVIRGDTFIQDYDE
CERKEDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWATSPERPLT
TAGTKAAFVQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESIPESSLYLS
HPSCNVSHSNGTHVLLEAGWSECGTLMQSNMTNTVVRTTLRNDLSQEGIIHHLKILSPIY
CAFQNDLLTSSGFTLEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSASDDVRIE
VGLYRQKSNLKVVLTECWATPSSNARDPITFSFINNSCPVPNTYTNVIENGNSNKAQFKL
RIFSFINDSIVYLHCKLRVCMESPGATCKINCNNFRLLQNSETSATHQMSWGPLIRSEGE
PPHAEAGLGAGYVVLIVVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFSYQVFYE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5DID3	0.234	0.234	0.000	1319	0.619	0.619	Q5DID3.pdb.gz	UROL1_MOUSE Uromodulin-like 1 OS=Mus musculus OX=10090 GN=Umodl1 PE=1 SV=1
2	PDB:4wrnA	0.108	0.200	1.010E-16	693	0.067	0.127	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
3	PDB:4wrnB	0.109	0.209	5.196E-15	663	0.056	0.112	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
4	AFDB:Q9TXR6	0.097	0.115	6.298E-11	1094	0.093	0.112	Q9TXR6.pdb.gz	Q9TXR6_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=2
5	AFDB:Q8JIR8	0.079	0.110	2.422E-10	928	0.092	0.130	Q8JIR8.pdb.gz	IMPG1_CHICK Interphotoreceptor matrix proteoglycan 1 OS=Gallus gallus OX=9031 GN=IMPG1 PE=1 SV=1
6	PDB:5hzvA	0.098	0.194	4.751E-10	598	0.022	0.048	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
7	AFDB:P43146	0.070	0.066	4.159E-9	1447	0.083	0.075	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
8	AFDB:E1C597	0.065	0.150	7.955E-9	537	0.058	0.142	E1C597.pdb.gz
9	AFDB:P97603	0.070	0.068	2.140E-7	1377	0.069	0.066	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
10	AFDB:A0A0B4K6Z6	0.074	0.055	4.997E-7	2037	0.093	0.060	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
11	AFDB:A1Z8J4	0.085	0.073	2.466E-6	1557	0.137	0.116	A1Z8J4.pdb.gz	A1Z8J4_DROME No mechanoreceptor potential A, isoform A OS=Drosophila melanogaster OX=7227 GN=nompA PE=4 SV=1
12	AFDB:A0A338P6W9	0.065	0.095	6.053E-6	884	0.075	0.112	A0A338P6W9.pdb.gz	A0A338P6W9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
13	AFDB:A0A0C4DHF6	0.071	0.073	2.572E-5	1262	0.101	0.105	A0A0C4DHF6.pdb.gz	A0A0C4DHF6_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
14	PDB:2rcjC	0.069	0.137	1.756E-4	523	0.036	0.090	2rcjC.pdb.gz
15	PDB:1e07A	0.081	0.137	1.846E-4	642	0.030	0.062	1e07A.pdb.gz
16	PDB:1igaA	0.066	0.129	2.368E-4	475	0.044	0.122	1igaA.pdb.gz
17	PDB:5iv5BJ	0.060	0.077	2.489E-4	1004	0.046	0.060	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
18	PDB:5a42A	0.083	0.072	4.761E-4	1597	0.070	0.058	5a42A.pdb.gz
19	PDB:3d4gE	0.070	0.186	6.751E-4	472	0.017	0.049	3d4gE.pdb.gz	Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
20	PDB:4ziqA	0.070	0.066	7.841E-4	1450	0.067	0.061	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5DID3	0.0	1639	1319	0.626	0.625	UROL1_MOUSE Uromodulin-like 1 OS=Mus musculus OX=10090 GN=Umodl1 PE=1 SV=1
2	P27590	2.97e-22	105	644	0.064	0.130	UROM_RAT Uromodulin OS=Rattus norvegicus OX=10116 GN=Umod PE=2 SV=1
3	P07911	1.07e-21	103	640	0.061	0.125	UROM_HUMAN Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1
4	Q91X17	1.12e-19	97.4	642	0.061	0.126	UROM_MOUSE Uromodulin OS=Mus musculus OX=10090 GN=Umod PE=1 SV=1
5	Q9D733	9.50e-19	94.0	531	0.056	0.139	GP2_MOUSE Pancreatic secretory granule membrane major glycoprotein GP2 OS=Mus musculus OX=10090 GN=Gp2 PE=1 SV=3
6	P19218	2.12e-17	89.7	530	0.056	0.140	GP2_RAT Pancreatic secretory granule membrane major glycoprotein GP2 OS=Rattus norvegicus OX=10116 GN=Gp2 PE=1 SV=1
7	P25291	9.89e-16	84.3	509	0.052	0.136	GP2_CANLF Pancreatic secretory granule membrane major glycoprotein GP2 OS=Canis lupus familiaris OX=9615 GN=GP2 PE=1 SV=1
8	P55259	5.29e-14	79.0	537	0.059	0.145	GP2_HUMAN Pancreatic secretory granule membrane major glycoprotein GP2 OS=Homo sapiens OX=9606 GN=GP2 PE=1 SV=3
9	O08523	1.76e-11	71.6	2155	0.055	0.034	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
10	O88393	6.78e-11	69.3	850	0.053	0.082	TGBR3_MOUSE Transforming growth factor beta receptor type 3 OS=Mus musculus OX=10090 GN=Tgfbr3 PE=1 SV=1
11	P26342	1.15e-10	68.6	853	0.052	0.080	TGBR3_RAT Transforming growth factor beta receptor type 3 OS=Rattus norvegicus OX=10116 GN=Tgfbr3 PE=1 SV=1
12	O08524	1.32e-10	66.6	329	0.027	0.109	TECTB_MOUSE Beta-tectorin OS=Mus musculus OX=10090 GN=Tectb PE=1 SV=2
13	O75443	4.52e-10	67.0	2155	0.054	0.033	TECTA_HUMAN Alpha-tectorin OS=Homo sapiens OX=9606 GN=TECTA PE=1 SV=3
14	Q96PL2	5.90e-10	64.7	329	0.027	0.109	TECTB_HUMAN Beta-tectorin OS=Homo sapiens OX=9606 GN=TECTB PE=2 SV=1
15	Q5PR99	2.79e-08	59.7	336	0.029	0.113	Q5PR99_DANRE Beta tectorin OS=Danio rerio OX=7955 GN=zgc:101843 PE=2 SV=1
16	Q8WWZ8	2.90e-08	60.5	545	0.064	0.154	OIT3_HUMAN Oncoprotein-induced transcript 3 protein OS=Homo sapiens OX=9606 GN=OIT3 PE=1 SV=2
17	Q6V0K7	2.04e-07	57.8	546	0.049	0.117	OIT3_RAT Oncoprotein-induced transcript 3 protein OS=Rattus norvegicus OX=10116 GN=Oit3 PE=2 SV=1
18	A0A0H3UK16	3.41e-07	57.4	848	0.054	0.084	A0A0H3UK16_DANRE Transforming growth factor beta receptor III OS=Danio rerio OX=7955 GN=si:ch73-18k18.1 PE=2 SV=1
19	E7FDB6	5.72e-07	56.6	848	0.054	0.084	E7FDB6_DANRE Transforming growth factor, beta receptor III OS=Danio rerio OX=7955 GN=tgfbr3 PE=1 SV=1
20	Q03167	1.20e-06	55.5	851	0.049	0.076	TGBR3_HUMAN Transforming growth factor beta receptor type 3 OS=Homo sapiens OX=9606 GN=TGFBR3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12947 EGF_3	0.059	24.9	EGF domain
2	PF07645 EGF_CA	5.4e-16	69.8	Calcium-binding EGF domain
3	PF00041 fn3	0.0085	27.7	Fibronectin type III domain
4	PF06247 Plasmod_Pvs28	6e+02	12.2	Pvs28 EGF domain
5	PF18370 RGI_lyase	71	15.1	Rhamnogalacturonan I lyases beta-sheet domain
6	PF01390 SEA	3.1e-10	51.5	SEA domain
7	PF00095 WAP	0.00029	32.5	WAP-type (Whey Acidic Protein) 'four-disulfide core'
8	PF00100 Zona_pellucida	5e-37	139.6	Zona pellucida-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000004404

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005474	0.690	ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent
2	60711.ENSCSAP00000006029	0.690	Small integral membrane protein 29
3	60711.ENSCSAP00000006098	0.652	Myosin, heavy chain 8, skeletal muscle, perinatal
4	60711.ENSCSAP00000016850	0.573	Zinc finger, MYND-type containing 12
5	60711.ENSCSAP00000011787	0.565	Myosin IG
6	60711.ENSCSAP00000006327	0.533	Myosin, heavy chain 13, skeletal muscle
7	60711.ENSCSAP00000010193	0.531	Myosin IC
8	60711.ENSCSAP00000003073	0.510	Testis expressed 28
9	60711.ENSCSAP00000017717	0.509	Zinc finger and BTB domain containing 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0097367	0.533	carbohydrate derivative binding
GO:0005198	0.367	structural molecule activity
GO:0004888	0.311	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.958	biological regulation
GO:0050896	0.924	response to stimulus
GO:0050789	0.917	regulation of biological process
GO:0051716	0.908	cellular response to stimulus
GO:0050794	0.854	regulation of cellular process
GO:0032501	0.752	multicellular organismal process
GO:0032502	0.497	developmental process
GO:0048856	0.479	anatomical structure development
GO:0060612	0.438	adipose tissue development
GO:1904035	0.438	regulation of epithelial cell apoptotic process
GO:0019222	0.425	regulation of metabolic process
GO:0060255	0.412	regulation of macromolecule metabolic process
GO:0009566	0.402	fertilization
GO:0071310	0.402	cellular response to organic substance
GO:0009719	0.394	response to endogenous stimulus
GO:0010468	0.381	regulation of gene expression
GO:0071495	0.371	cellular response to endogenous stimulus
GO:2000241	0.359	regulation of reproductive process
GO:1901700	0.350	response to oxygen-containing compound
GO:1901698	0.348	response to nitrogen compound
GO:0010243	0.330	response to organonitrogen compound
GO:1901652	0.305	response to peptide
GO:0007338	0.301	single fertilization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005886	0.996	plasma membrane
GO:0005615	0.989	extracellular space
GO:0009986	0.946	cell surface
GO:0009897	0.936	external side of plasma membrane
GO:0005622	0.773	intracellular anatomical structure
GO:0043226	0.769	organelle
GO:0043227	0.738	membrane-bounded organelle
GO:0005737	0.678	cytoplasm
GO:0043229	0.598	intracellular organelle
GO:0031982	0.563	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]