StarFunc result for job id Q5EBL2

User Input

>input (1059 residues)
MSGVMVGSHADMAPASTAEGAGEKPGPAAPAPAAQYECGECGKSFRWSSRLLHHQRTHTG
ERPYKCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRSVHTGLRAF
ICGQCGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYTCGV
CGKSFTQSTNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLHQRTHGAAPAPGTASAAPP
PQSREPGKVFVCDAYLQRHLQPHSPPAPPAPPPPPPPVVPELFLAAAETTVELVYRCDGC
EQGFSSEELLLEHQPCPGPDAAPQPQEAPAEAPKADQPPSPLPQPPPPAAAPAPGFACLP
CGKSFRTVAGLSRHQHSHGAAGGQAFRCGSCDGSFPQLASLLAHQQCHVEEAAAGRPPPQ
AEAAEVTCPQEPLAPAAPVPPPPPSAPASAERPYKCAECGKSFKGSSGLRYHLRDHTGER
PYQCGECGKAFKRSSLLAIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRLHSGERPYAC
GECGKAFRNTSCLRRHRHVHTGERPHACGVCGKSFAQTSNLRQHQRVHTGERPFRCPLCP
KTFTHSSNLLLHQRTHSAERPFTCPICGRGFVMAAYLQRHLRTHAPANTPPSTTAPAAGP
QPPAPLAAARAPPATQDVHVLPHLQATLSLEVAGGTAQAPSLGPAAPNSQTFLLVQTAQG
LQLIPSSVQPPTPPPPPAPPKLILLPSSSAGAGGGRARQGPRAVGKAGQGAGVVWLPGPG
GLGVQGAASAGASGTGQSLIVLQNVGGGEAGPQEMSGVQLQPLRPAPEVTTVQLQPAQEV
TTVQLQPAQEVTTVQLQPAQEVTTVQLQPVAGQLSNSSGGAVATEAPNLLVVQSGAAEEL
LTGPGPGEAGDGEASTGVVQDVLFETLQTDEGLQSVLVLSGADGEQTRLCVQEVETLPPG
LTEPPATGPPGQKLLIIRSAPATELLDSSNTGGGTATLQLLAPPPSGPASGPAGLPGAPA
SQMVQVVPAGAGPGVMTPQGLPSIQIVQTLPAVQLVHTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5EBL2	1.000	1.000	0.000	1059	1.000	1.000	Q5EBL2.pdb.gz	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
2	AFDB:Q8CJ78	0.196	0.199	0.000	1038	0.855	0.872	Q8CJ78.pdb.gz	ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus OX=10090 GN=Znf628 PE=1 SV=2
3	AFDB:O75290	0.170	0.269	7.945E-49	641	0.184	0.304	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
4	AFDB:Q9UJW7	0.171	0.217	1.380E-48	825	0.226	0.290	Q9UJW7.pdb.gz	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
5	AFDB:Q62788	0.169	0.236	1.865E-46	744	0.211	0.300	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
6	AFDB:A0A024R4I3	0.170	0.268	1.411E-45	652	0.189	0.307	A0A024R4I3.pdb.gz
7	AFDB:Q8BFS8	0.136	0.206	1.535E-42	652	0.184	0.299	Q8BFS8.pdb.gz	ZN418_MOUSE Zinc finger protein 418 OS=Mus musculus OX=10090 GN=ZNF418 PE=2 SV=1
8	AFDB:Q8NEP9	0.154	0.243	2.085E-42	628	0.180	0.304	Q8NEP9.pdb.gz	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
9	AFDB:P15622	0.152	0.264	3.168E-38	560	0.180	0.341	P15622.pdb.gz	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
10	AFDB:Q9UJW8	0.155	0.225	6.221E-38	692	0.165	0.253	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
11	PDB:3w5kB	0.055	0.279	1.401E-4	110	0.037	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6o9lQ	0.034	0.070	2.992E-1	430	0.044	0.109	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
13	PDB:5c8dE	0.050	0.118	5.524E-1	280	0.025	0.093	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
14	PDB:2jz4A	0.023	0.061	1.567	299	0.009	0.033	2jz4A.pdb.gz
15	PDB:8escZ	0.031	0.009	1.771	3543	0.007	0.002	8escZ.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
16	PDB:4fjcE	0.037	0.061	1.884	434	0.030	0.074	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
17	PDB:7ni5A	0.033	0.013	1.884	2791	0.008	0.003	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
18	PDB:5lj5t	0.027	0.053	2.264	438	0.019	0.046	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:7dvqM	0.024	0.099	2.264	191	0.030	0.168	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:8a5yT	0.038	0.049	2.264	650	0.025	0.042	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5EBL2	0.0	2096	1059	1.000	1.000	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
2	Q8CJ78	0.0	1558	1038	0.845	0.862	ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus OX=10090 GN=Znf628 PE=1 SV=2
3	Q7TMN8	1.86e-132	415	578	0.223	0.408	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
4	Q8TAQ5	2.25e-132	419	688	0.225	0.346	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
5	Q8BLA2	4.62e-132	414	578	0.223	0.408	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
6	Q9P2J8	5.34e-131	421	865	0.219	0.268	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	Q05481	9.70e-130	426	1191	0.228	0.202	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	P17038	2.31e-128	412	809	0.217	0.284	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
9	Q5TYW1	2.51e-127	416	1059	0.218	0.218	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
10	Q14587	6.98e-125	406	947	0.216	0.242	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
11	A0A0U1RQ46	3.62e-122	389	609	0.222	0.386	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
12	Q9UJW7	4.32e-121	393	825	0.225	0.288	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
13	A0A087WSF4	1.19e-120	386	635	0.202	0.337	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
14	E9Q981	1.29e-120	386	636	0.202	0.336	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
15	Q96JF6	6.43e-119	387	807	0.221	0.290	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
16	Q9UII5	8.38e-119	385	783	0.210	0.284	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
17	Q86WZ6	8.95e-118	383	799	0.225	0.298	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
18	P51523	1.04e-117	381	738	0.209	0.299	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
19	G3V9G6	2.03e-115	375	740	0.212	0.304	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
20	Q62788	2.75e-115	375	744	0.212	0.302	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	6.7e+02	12.1	BolA-like protein
2	PF20026 DUF6434	1.2e+02	14.1	Domain of unknown function (DUF6434)
3	PF09237 GAGA	0.071	24.5	GAGA factor
4	PF00096 zf-C2H2	5.5e-79	267.6	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	1.2e-41	148.8	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1.5e+02	13.8	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	1.3e-23	93.9	Zinc-finger double-stranded RNA-binding
8	PF13913 zf-C2HC_2	8.2e+02	11.3	zinc-finger of a C2HC-type
9	PF05605 zf-Di19	18	17.0	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	1.2e-90	305.4	Zinc-finger double domain
11	PF12874 zf-met	1e-05	37.0	Zinc-finger of C2H2 type
12	PF17032 zinc_ribbon_15	92	15.2	zinc-ribbon family
13	PF09723 Zn-ribbon_8	3.3	19.2	Zinc ribbon domain
14	PF17283 Zn_ribbon_SprT	0.035	25.4	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412886	0.765	Calmodulin-binding transcription activator 2
2	9606.ENSP00000401508	0.753	Nicotinate phosphoribosyltransferase
3	9606.ENSP00000261891	0.724	Death-associated protein kinase 2
4	9606.ENSP00000206423	0.723	Coiled-coil domain-containing protein 80
5	9606.ENSP00000354622	0.703	RUN domain-containing protein 1
6	9606.ENSP00000463092	0.695	Beta-microseminoprotein
7	9606.ENSP00000442973	0.681	Death-associated protein kinase 3
8	9606.ENSP00000358854	0.675	Transcription initiation factor TFIID subunit 5
9	9606.ENSP00000381567	0.607	TATA element modulatory factor
10	9606.ENSP00000375919	0.604	Protein Smaug homolog 1
11	9606.ENSP00000226225	0.600	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
12	9606.ENSP00000387006	0.599	Pre-mRNA-splicing factor CWC22 homolog
13	9606.ENSP00000296955	0.502	Discoidin, CUB and LCCL domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.791	organic cyclic compound binding
GO:1901363	0.790	heterocyclic compound binding
GO:0003676	0.553	nucleic acid binding
GO:0140110	0.428	transcription regulator activity
GO:0003700	0.311	DNA-binding transcription factor activity
GO:0003677	0.306	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0010468	0.975	regulation of gene expression
GO:0080090	0.956	regulation of primary metabolic process
GO:0051252	0.951	regulation of RNA metabolic process
GO:0010556	0.936	regulation of macromolecule biosynthetic process
GO:0031326	0.936	regulation of cellular biosynthetic process
GO:0006355	0.896	regulation of DNA-templated transcription
GO:0032501	0.846	multicellular organismal process
GO:0032502	0.758	developmental process
GO:0009987	0.596	cellular process
GO:0000003	0.470	reproduction
GO:0048232	0.391	male gamete generation
GO:0048518	0.381	positive regulation of biological process
GO:0048522	0.368	positive regulation of cellular process
GO:0071704	0.309	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.971	intracellular organelle lumen
GO:0031981	0.769	nuclear lumen
GO:0005654	0.753	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]