StarFunc result for job id Q5EBM0

User Input

>input (449 residues)
MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDP
RLAALLGPPERSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCP
GGQAGGAQQGFLLRDPLDDPDTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQ
DGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLV
DQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVLLKSPPSCIGQWRKIFDDEPT
IIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQHLPPAHHPVY
QWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP
GCHVVDASPSREKVLQTVLSLIQNSFSEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5EBM0	1.000	1.000	3.483E-94	449	1.000	1.000	Q5EBM0.pdb.gz	CMPK2_HUMAN UMP-CMP kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CMPK2 PE=1 SV=3
2	AFDB:D3ZC63	0.914	0.918	1.280E-70	447	0.719	0.723	D3ZC63.pdb.gz	D3ZC63_RAT Cytidine/uridine monophosphate kinase 2 OS=Rattus norvegicus OX=10116 GN=Cmpk2 PE=1 SV=3
3	PDB:1e2fA	0.351	0.706	4.069E-8	210	0.102	0.219	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
4	AFDB:D3ZUJ5	0.341	0.683	5.033E-8	212	0.116	0.245	D3ZUJ5.pdb.gz	D3ZUJ5_RAT dTMP kinase OS=Rattus norvegicus OX=10116 GN=Dtymk PE=3 SV=2
5	AFDB:P97930	0.347	0.689	5.637E-8	212	0.109	0.231	P97930.pdb.gz	KTHY_MOUSE Thymidylate kinase OS=Mus musculus OX=10090 GN=Dtymk PE=1 SV=2
6	AFDB:P23919	0.350	0.700	6.314E-8	212	0.105	0.222	P23919.pdb.gz	KTHY_HUMAN Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4
7	AFDB:Q57YW2	0.328	0.418	6.682E-8	345	0.098	0.128	Q57YW2.pdb.gz	Q57YW2_TRYB2 dTMP kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.680 PE=3 SV=1
8	AFDB:F4KJ62	0.346	0.553	7.922E-8	271	0.107	0.177	F4KJ62.pdb.gz	F4KJ62_ARATH dTMP kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=1 SV=1
9	AFDB:P36590	0.330	0.664	1.564E-7	210	0.116	0.248	P36590.pdb.gz	KTHY_SCHPO Thymidylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tmp1 PE=1 SV=2
10	AFDB:Q97R91	0.364	0.714	1.564E-7	212	0.100	0.212	Q97R91.pdb.gz	KTHY_STRPN Thymidylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=tmk PE=1 SV=1
11	AFDB:P00572	0.341	0.676	4.101E-7	216	0.109	0.227	P00572.pdb.gz	KTHY_YEAST Thymidylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC8 PE=1 SV=2
12	PDB:3tmkA	0.300	0.568	4.659E-7	216	0.116	0.241	3tmkA.pdb.gz	Crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-thymidyl) pentaphosphate (TP5A) at 2.0 A resolution: implications for catalysis and AZT activation.
13	PDB:4tmkA	0.359	0.702	8.214E-7	210	0.111	0.238	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
14	PDB:2wwfC	0.331	0.646	1.717E-6	212	0.096	0.203	2wwfC.pdb.gz	Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
15	PDB:2cdnA	0.257	0.550	2.154E-6	186	0.080	0.194	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
16	PDB:2c95A	0.271	0.552	3.797E-6	195	0.062	0.144	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
17	PDB:1ukyA	0.266	0.541	9.954E-6	196	0.071	0.163	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
18	PDB:3iijA	0.257	0.577	2.080E-5	175	0.067	0.171	3iijA.pdb.gz	hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
19	PDB:1kdoA	0.219	0.402	2.466E-5	223	0.082	0.166	1kdoA.pdb.gz	Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
20	PDB:5nrnB	0.312	0.604	2.466E-5	211	0.098	0.209	5nrnB.pdb.gz	Mtb TMK crystal structure in complex with compound LS3080

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZC63	0.0	611	447	0.726	0.729	D3ZC63_RAT Cytidine/uridine monophosphate kinase 2 OS=Rattus norvegicus OX=10116 GN=Cmpk2 PE=1 SV=3
2	Q3U5Q7	0.0	626	447	0.742	0.745	CMPK2_MOUSE UMP-CMP kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Cmpk2 PE=1 SV=2
3	Q5EBM0	0.0	905	449	1.000	1.000	CMPK2_HUMAN UMP-CMP kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CMPK2 PE=1 SV=3
4	P36590	4.03e-05	47.0	210	0.127	0.271	KTHY_SCHPO Thymidylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tmp1 PE=1 SV=2
5	O00142	0.005	40.8	265	0.087	0.147	KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TK2 PE=1 SV=4
6	P00572	0.006	40.4	216	0.118	0.245	KTHY_YEAST Thymidylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC8 PE=1 SV=2
7	P0A720	0.021	38.5	213	0.120	0.254	KTHY_ECOLI Thymidylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=tmk PE=1 SV=1
8	F4KJ62	0.058	37.7	271	0.127	0.210	F4KJ62_ARATH dTMP kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=1 SV=1
9	Q0WW55	0.063	37.7	263	0.127	0.217	ZEUS1_ARATH Thymidylate kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=2 SV=1
10	O26009	0.090	36.6	191	0.111	0.262	KTHY_HELPY Thymidylate kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=tmk PE=1 SV=1
11	Q9R088	0.10	37.0	270	0.089	0.148	KITM_MOUSE Thymidine kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Tk2 PE=1 SV=2
12	D3ZGQ2	0.69	34.3	270	0.085	0.141	D3ZGQ2_RAT Thymidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Tk2 PE=3 SV=1
13	Q97R91	0.73	33.9	212	0.118	0.250	KTHY_STRPN Thymidylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=tmk PE=1 SV=1
14	Q381V9	0.99	34.3	769	0.045	0.026	Q381V9_TRYB2 Clu domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6390 PE=4 SV=1
15	Q8R0H9	4.0	32.3	635	0.069	0.049	GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus OX=10090 GN=Gga1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	13	17.6	AAA domain
2	PF13238 AAA_18	0.0081	28.1	AAA domain
3	PF13671 AAA_33	0.0018	29.9	AAA domain
4	PF01712 dNK	0.46	21.8	Deoxynucleoside kinase
5	PF03562 MltA	5e+02	11.8	MltA specific insert domain
6	PF02223 Thymidylate_kin	3.9e-14	64.3	Thymidylate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371471	0.974	Radical S-adenosyl methionine domain-containing protein 2
2	9606.ENSP00000219479	0.961	Nucleoside diphosphate kinase, mitochondrial
3	9606.ENSP00000232607	0.955	Uridine 5'-monophosphate synthase
4	9606.ENSP00000376889	0.954	Nucleoside diphosphate kinase
5	9606.ENSP00000373674	0.951	5'(3')-deoxyribonucleotidase, mitochondrial
6	9606.ENSP00000265191	0.943	Nucleoside diphosphate kinase homolog 5
7	9606.ENSP00000356785	0.943	Nucleoside diphosphate kinase 7
8	9606.ENSP00000376886	0.943	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
9	9606.ENSP00000300738	0.941	Ribonucleoside-diphosphate reductase large subunit
10	9606.ENSP00000286648	0.940	Deoxycytidine kinase
11	9606.ENSP00000410186	0.938	Adenylate kinase 9
12	9606.ENSP00000337060	0.937	Nucleoside diphosphate kinase A
13	9606.ENSP00000484415	0.936	Cytosolic 5'-nucleotidase 3A
14	9606.ENSP00000322524	0.930	dCTP pyrophosphatase 1
15	9606.ENSP00000362481	0.930	Uracil phosphoribosyltransferase homolog
16	9606.ENSP00000352904	0.929	Cytosolic 5'-nucleotidase 1B
17	9606.ENSP00000219302	0.928	Nucleoside diphosphate kinase 3
18	9606.ENSP00000349576	0.928	Deoxycytidylate deaminase
19	9606.ENSP00000251810	0.926	Ribonucleoside-diphosphate reductase subunit M2 B
20	9606.ENSP00000356853	0.925	Uridine-cytidine kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004550	1.000	nucleoside diphosphate kinase activity
GO:0009041	1.000	uridylate kinase activity
GO:0033862	0.823	UMP kinase activity
GO:0004127	0.809	cytidylate kinase activity
GO:0005488	0.453	binding
GO:0005515	0.416	protein binding
GO:0004798	0.308	thymidylate kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0055086	0.995	nucleobase-containing small molecule metabolic process
GO:0006753	0.993	nucleoside phosphate metabolic process
GO:1901576	0.986	organic substance biosynthetic process
GO:0090407	0.959	organophosphate biosynthetic process
GO:0034654	0.959	nucleobase-containing compound biosynthetic process
GO:0009117	0.957	nucleotide metabolic process
GO:0009132	0.955	nucleoside diphosphate metabolic process
GO:1901293	0.954	nucleoside phosphate biosynthetic process
GO:1901564	0.597	organonitrogen compound metabolic process
GO:0050896	0.587	response to stimulus
GO:0009141	0.531	nucleoside triphosphate metabolic process
GO:0016310	0.452	phosphorylation
GO:1901135	0.451	carbohydrate derivative metabolic process
GO:0006165	0.355	nucleoside diphosphate phosphorylation
GO:0072527	0.328	pyrimidine-containing compound metabolic process
GO:0065007	0.309	biological regulation
GO:0009165	0.300	nucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005654	0.999	nucleoplasm
GO:0005829	0.971	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.6	1.000	nucleoside-diphosphate kinase.
EC:2.7.4.22	1.000	UMP kinase.
RHEA:24400	0.823	ATP + UMP = ADP + UDP
EC:2.7.4.14	0.809	UMP/CMP kinase.
RHEA:13517	0.308	ATP + dTMP = ADP + dTDP
EC:2.7.4.9	0.308	dTMP kinase.

[back to server]