StarFunc result for job id Q5EG05

User Input

>input (197 residues)
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDA
QRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYP
RIPGLGKELQTGTHKLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5EG05	1.000	1.000	1.392E-28	197	1.000	1.000	Q5EG05.pdb.gz	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
2	AFDB:P29466	0.464	0.228	3.708E-14	404	0.584	0.285	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
3	AFDB:Q5XLA6	0.462	0.820	4.207E-11	110	0.396	0.709	Q5XLA6.pdb.gz	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
4	AFDB:P29452	0.450	0.224	5.188E-10	402	0.365	0.179	P29452.pdb.gz	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
5	AFDB:P43527	0.450	0.225	8.574E-10	402	0.350	0.172	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
6	AFDB:P57730	0.446	0.965	2.583E-8	90	0.254	0.556	P57730.pdb.gz	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
7	AFDB:A0A060XPX2	0.446	0.250	4.773E-8	353	0.239	0.133	A0A060XPX2.pdb.gz	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
8	PDB:1dgnA	0.407	0.866	3.724E-6	89	0.239	0.528	1dgnA.pdb.gz
9	AFDB:A0A0S2Z4Z8	0.395	0.147	7.060E-4	540	0.122	0.044	A0A0S2Z4Z8.pdb.gz	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
10	AFDB:A0A2U9DQQ3	0.355	0.169	7.465E-4	436	0.102	0.046	A0A2U9DQQ3.pdb.gz
11	AFDB:A0A060WPC3	0.418	0.148	8.347E-4	589	0.132	0.044	A0A060WPC3.pdb.gz	A0A060WPC3_ONCMY Receptor-interacting serine/threonine-protein kinase 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00058388001 PE=4 SV=1
12	PDB:6mksA	0.408	0.870	2.162E-3	90	0.112	0.244	6mksA.pdb.gz
13	PDB:4ikmA	0.412	0.179	2.418E-3	463	0.142	0.060	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
14	PDB:5juyB	0.365	0.063	4.225E-3	1234	0.132	0.021	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
15	PDB:4irlB	0.400	0.177	3.152E-2	463	0.086	0.037	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
16	PDB:6ki0A	0.358	0.159	3.727E-2	459	0.117	0.050	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
17	PDB:2kn6A	0.334	0.336	1.138E-1	195	0.122	0.123	2kn6A.pdb.gz
18	PDB:7pzcA	0.282	0.066	5.139E-1	1010	0.107	0.021	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
19	PDB:4a2wA	0.361	0.114	6.076E-1	678	0.081	0.024	4a2wA.pdb.gz
20	PDB:4m9sB	0.354	0.149	1.569	511	0.076	0.029	4m9sB.pdb.gz	Mechanistic insights into CED-4-mediated activation of CED-3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5EG05	3.02e-148	411	197	1.000	1.000	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
2	P29466	3.93e-71	223	404	0.589	0.287	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
3	Q5XLA6	2.50e-46	150	110	0.386	0.691	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
4	P29452	2.72e-33	124	402	0.371	0.182	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
5	P43527	3.24e-33	124	402	0.365	0.179	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
6	P57730	3.61e-28	103	90	0.254	0.556	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
7	A0A060XPX2	2.01e-15	75.5	353	0.228	0.127	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
8	E9PMT1	6.29e-04	40.8	147	0.188	0.252	E9PMT1_HUMAN Caspase 4 (Fragment) OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
9	P49662	0.001	41.6	377	0.127	0.066	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
10	O75601	0.005	39.3	377	0.178	0.093	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
11	Q920D5	0.005	39.3	420	0.112	0.052	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
12	Q9Y2G2	0.007	38.9	537	0.127	0.047	CARD8_HUMAN Caspase recruitment domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CARD8 PE=1 SV=2
13	A0A8I6ADV9	0.038	36.6	537	0.112	0.041	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
14	Q6P6S1	0.046	36.6	589	0.112	0.037	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
15	O08736	0.052	36.2	419	0.096	0.045	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
16	Q9NPP4	0.081	35.8	1024	0.102	0.020	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
17	Q13490	0.089	35.8	618	0.107	0.034	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
18	F7FLN8	0.14	35.0	602	0.091	0.030	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
19	A0A0G2JTI9	0.16	35.0	638	0.091	0.028	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
20	Q5XIW4	0.16	35.0	602	0.091	0.030	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	4e-22	89.3	Caspase recruitment domain
2	PF04762 IKI3	2.6e+02	11.0	IKI3 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.946	Caspase-1
2	9606.ENSP00000333203	0.900	Plasma serine protease inhibitor
3	9606.ENSP00000247470	0.860	Apoptosis-associated speck-like protein containing a CARD
4	9606.ENSP00000364859	0.850	Caspase recruitment domain-containing protein 17
5	9606.ENSP00000436691	0.807	Caspase recruitment domain-containing protein 18
6	9606.ENSP00000337383	0.771	NACHT, LRR and PYD domains-containing protein 3
7	9606.ENSP00000376849	0.765	Caspase-5
8	9606.ENSP00000385090	0.757	NLR family CARD domain-containing protein 4
9	9606.ENSP00000219596	0.740	Pyrin
10	9606.ENSP00000484343	0.739	Serpin B6
11	9606.ENSP00000357112	0.720	Interferon-inducible protein AIM2
12	9606.ENSP00000375682	0.720	Kallikrein-8
13	9606.ENSP00000220751	0.702	Receptor-interacting serine/threonine-protein kinase 2
14	9606.ENSP00000323076	0.696	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
15	9606.ENSP00000263341	0.687	Interleukin-1 beta
16	9606.ENSP00000388566	0.662	Caspase-4
17	9606.ENSP00000292174	0.637	C-X-C chemokine receptor type 5
18	9606.ENSP00000445135	0.629	NACHT, LRR and PYD domains-containing protein 2
19	9606.ENSP00000448165	0.609	Apoptotic protease-activating factor 1
20	9606.ENSP00000375767	0.604	Caspase recruitment domain-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019904	1.000	protein domain specific binding
GO:0019900	1.000	kinase binding
GO:0089720	1.000	caspase binding
GO:0004869	1.000	cysteine-type endopeptidase inhibitor activity
GO:0050700	0.978	CARD domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043122	0.990	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006950	0.989	response to stress
GO:0032651	0.989	regulation of interleukin-1 beta production
GO:0104004	0.988	cellular response to environmental stimulus
GO:0009967	0.987	positive regulation of signal transduction
GO:0043281	0.985	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1902533	0.982	positive regulation of intracellular signal transduction
GO:0071214	0.981	cellular response to abiotic stimulus
GO:0044092	0.980	negative regulation of molecular function
GO:0042981	0.979	regulation of apoptotic process
GO:0032101	0.978	regulation of response to external stimulus
GO:0071222	0.978	cellular response to lipopolysaccharide
GO:0048523	0.975	negative regulation of cellular process
GO:0006355	0.974	regulation of DNA-templated transcription
GO:0010803	0.971	regulation of tumor necrosis factor-mediated signaling pathway
GO:0044093	0.966	positive regulation of molecular function
GO:0002831	0.960	regulation of response to biotic stimulus
GO:0051346	0.954	negative regulation of hydrolase activity
GO:0051248	0.944	negative regulation of protein metabolic process
GO:0010951	0.934	negative regulation of endopeptidase activity
GO:0070613	0.931	regulation of protein processing
GO:0032692	0.928	negative regulation of interleukin-1 production
GO:2000117	0.924	negative regulation of cysteine-type endopeptidase activity
GO:0070482	0.923	response to oxygen levels
GO:0010955	0.920	negative regulation of protein processing
GO:0051098	0.914	regulation of binding
GO:0048585	0.913	negative regulation of response to stimulus
GO:0009314	0.834	response to radiation
GO:0043393	0.809	regulation of protein binding
GO:0036293	0.799	response to decreased oxygen levels
GO:0060761	0.781	negative regulation of response to cytokine stimulus
GO:0051100	0.778	negative regulation of binding
GO:0043123	0.745	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032091	0.700	negative regulation of protein binding
GO:0010604	0.683	positive regulation of macromolecule metabolic process
GO:0001666	0.591	response to hypoxia
GO:0033554	0.535	cellular response to stress
GO:0051173	0.532	positive regulation of nitrogen compound metabolic process
GO:0051240	0.470	positive regulation of multicellular organismal process
GO:0010628	0.426	positive regulation of gene expression
GO:0001819	0.417	positive regulation of cytokine production
GO:0051247	0.412	positive regulation of protein metabolic process
GO:0080134	0.370	regulation of response to stress
GO:0006952	0.364	defense response
GO:0045862	0.362	positive regulation of proteolysis
GO:0051345	0.361	positive regulation of hydrolase activity
GO:0032732	0.353	positive regulation of interleukin-1 production
GO:0032103	0.338	positive regulation of response to external stimulus
GO:0010952	0.337	positive regulation of peptidase activity
GO:0008152	0.335	metabolic process
GO:0010950	0.333	positive regulation of endopeptidase activity
GO:0031347	0.332	regulation of defense response
GO:0007165	0.329	signal transduction
GO:2001056	0.308	positive regulation of cysteine-type endopeptidase activity
GO:0031349	0.300	positive regulation of defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0110165	0.945	cellular anatomical entity
GO:1904090	0.864	peptidase inhibitor complex
GO:0005737	0.854	cytoplasm
GO:0043226	0.808	organelle
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0097179	0.526	protease inhibitor complex
GO:0016020	0.355	membrane
GO:0005829	0.312	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]