StarFunc result for job id Q5FVE4

User Input

>input (666 residues)
MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRES
VNRFGTYPALASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFI
TAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKA
IIQYRLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGV
MLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADA
LKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKK
MLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESET
ETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPII
SNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQD
PLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQ
IDHMYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJD4	0.977	0.977	0.000	666	1.000	1.000	A0A140VJD4.pdb.gz	A0A140VJD4_HUMAN Testicular tissue protein Li 8 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q2XU92	0.976	0.974	0.000	667	0.685	0.684	Q2XU92.pdb.gz	ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1
3	AFDB:Q924N5	0.935	0.865	4.113E-89	721	0.495	0.458	Q924N5.pdb.gz	ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus OX=10116 GN=Acsbg1 PE=1 SV=1
4	AFDB:Q96GR2	0.940	0.865	5.734E-89	724	0.491	0.452	Q96GR2.pdb.gz	ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens OX=9606 GN=ACSBG1 PE=1 SV=2
5	AFDB:Q9V3S9	0.943	0.943	5.536E-81	666	0.411	0.411	Q9V3S9.pdb.gz	BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster OX=7227 GN=bgm PE=1 SV=1
6	AFDB:Q9V3U0	0.933	0.912	2.975E-72	681	0.360	0.352	Q9V3U0.pdb.gz	HMLL_DROME Long-chain-fatty-acid--CoA ligase heimdall OS=Drosophila melanogaster OX=7227 GN=hll PE=1 SV=1
7	AFDB:O53521	0.802	0.885	1.937E-50	600	0.263	0.292	O53521.pdb.gz	FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD15 PE=1 SV=3
8	AFDB:Q8LKS5	0.815	0.777	2.990E-48	700	0.228	0.217	Q8LKS5.pdb.gz	LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LACS7 PE=1 SV=2
9	AFDB:P33121	0.809	0.774	7.253E-48	698	0.237	0.226	P33121.pdb.gz	ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1 PE=1 SV=1
10	AFDB:Q8W471	0.765	0.704	1.575E-47	727	0.198	0.182	Q8W471.pdb.gz	AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AAE15 PE=1 SV=1
11	PDB:6q2mA	0.671	0.812	6.585E-33	544	0.167	0.204	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
12	PDB:7kydA	0.606	0.745	8.145E-31	534	0.174	0.217	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
13	PDB:5bsmA	0.625	0.774	1.417E-30	530	0.177	0.223	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
14	PDB:3r44A	0.583	0.755	2.911E-30	502	0.152	0.201	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
15	PDB:5ie2A	0.626	0.807	1.100E-29	506	0.174	0.229	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
16	PDB:1ultA	0.564	0.692	4.154E-29	533	0.155	0.193	1ultA.pdb.gz
17	PDB:3b7wA	0.537	0.658	2.730E-28	537	0.153	0.190	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
18	PDB:5ja2A	0.517	0.289	5.306E-28	1238	0.147	0.079	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
19	PDB:3tsyA	0.539	0.437	4.977E-26	828	0.152	0.122	3tsyA.pdb.gz
20	PDB:5hm3A	0.608	0.645	4.977E-26	625	0.147	0.157	5hm3A.pdb.gz	Structure of the Essential Mtb FadD32 Enzyme: A Promising Drug Target for Treating Tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJD4	0.0	1383	666	1.000	1.000	A0A140VJD4_HUMAN Testicular tissue protein Li 8 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q2XU92	0.0	988	667	0.689	0.688	ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1
3	Q5FVE4	0.0	1383	666	1.000	1.000	ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens OX=9606 GN=ACSBG2 PE=1 SV=2
4	Q924N5	0.0	670	721	0.497	0.459	ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus OX=10116 GN=Acsbg1 PE=1 SV=1
5	Q96GR2	0.0	660	724	0.489	0.450	ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens OX=9606 GN=ACSBG1 PE=1 SV=2
6	Q99PU5	0.0	668	721	0.495	0.458	ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus OX=10090 GN=Acsbg1 PE=1 SV=1
7	Q9V3S9	0.0	550	666	0.414	0.414	BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster OX=7227 GN=bgm PE=1 SV=1
8	Q9V3U0	9.00e-145	439	681	0.375	0.367	HMLL_DROME Long-chain-fatty-acid--CoA ligase heimdall OS=Drosophila melanogaster OX=7227 GN=hll PE=1 SV=1
9	O53521	2.87e-68	236	600	0.269	0.298	FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD15 PE=1 SV=3
10	P9WQ53	3.47e-59	211	571	0.212	0.247	FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD11 PE=3 SV=1
11	Q55DR6	7.30e-54	197	667	0.251	0.250	FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum OX=44689 GN=fcsA PE=1 SV=1
12	Q1ZXQ4	1.06e-49	186	673	0.254	0.251	FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum OX=44689 GN=fcsB PE=2 SV=1
13	Q9C7W4	6.44e-48	181	665	0.261	0.262	LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana OX=3702 GN=LACS3 PE=2 SV=1
14	Q9T0A0	7.56e-47	178	666	0.258	0.258	LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana OX=3702 GN=LACS4 PE=2 SV=1
15	Q9XIA9	1.02e-46	177	665	0.257	0.257	LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana OX=3702 GN=LACS2 PE=2 SV=1
16	Q8LPS1	4.93e-46	176	701	0.266	0.252	LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LACS6 PE=1 SV=1
17	C8V3Q2	8.01e-45	172	708	0.216	0.203	C8V3Q2_EMENI AMP-binding enzyme, putative (AFU_orthologue AFUA_5G04270) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08280 PE=4 SV=1
18	Q9T009	9.34e-44	169	666	0.249	0.249	LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana OX=3702 GN=LACS5 PE=2 SV=1
19	Q9CAP8	1.65e-42	166	691	0.260	0.250	LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LACS9 PE=1 SV=1
20	Q2I824	1.95e-42	165	662	0.281	0.282	Q2I824_GOSHI Long-chain-fatty-acid--CoA ligase OS=Gossypium hirsutum OX=3635 GN=ACS1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	3.2e-81	284.7	AMP-binding enzyme
2	PF09707 Cas_Cas2CT1978	14	17.2	CRISPR-associated protein (Cas_Cas2CT1978)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465589

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293217	0.960	Peroxisomal acyl-coenzyme A oxidase 1
2	9606.ENSP00000233710	0.949	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
3	9606.ENSP00000307697	0.944	Peroxisomal acyl-coenzyme A oxidase 2
4	9606.ENSP00000477602	0.938	Elongation of very long chain fatty acids protein 1
5	9606.ENSP00000304592	0.932	Fatty acid synthase
6	9606.ENSP00000378105	0.929	Elongation of very long chain fatty acids protein 6
7	9606.ENSP00000278840	0.928	Fatty acid desaturase 2
8	9606.ENSP00000285093	0.859	3-ketoacyl-CoA thiolase, mitochondrial
9	9606.ENSP00000333664	0.840	3-ketoacyl-CoA thiolase, peroxisomal
10	9606.ENSP00000309757	0.830	Lipoprotein lipase
11	9606.ENSP00000359871	0.823	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
12	9606.ENSP00000265052	0.808	Monoglyceride lipase
13	9606.ENSP00000438689	0.783	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
14	9606.ENSP00000485061	0.781	Long-chain fatty acid transport protein 3
15	9606.ENSP00000312618	0.779	Acyl-CoA dehydrogenase family member 9, mitochondrial
16	9606.ENSP00000263093	0.746	Bile acyl-CoA synthetase
17	9606.ENSP00000350012	0.740	Long-chain-fatty-acid--CoA ligase 3
18	9606.ENSP00000339787	0.736	Long-chain-fatty-acid--CoA ligase 4
19	9606.ENSP00000242592	0.731	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
20	9606.ENSP00000332111	0.730	EF-hand calcium-binding domain-containing protein 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004467	1.000	long-chain fatty acid-CoA ligase activity
GO:0016788	0.998	hydrolase activity, acting on ester bonds
GO:0031957	0.996	very long-chain fatty acid-CoA ligase activity
GO:0047617	0.992	acyl-CoA hydrolase activity
GO:0005488	0.860	binding
GO:0005515	0.462	protein binding
GO:0016740	0.398	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.976	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0006629	0.974	lipid metabolic process
GO:0032787	0.965	monocarboxylic acid metabolic process
GO:0044255	0.963	cellular lipid metabolic process
GO:0044249	0.958	cellular biosynthetic process
GO:1901576	0.957	organic substance biosynthetic process
GO:0006631	0.951	fatty acid metabolic process
GO:0035384	0.926	thioester biosynthetic process
GO:0034030	0.926	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.926	purine nucleoside bisphosphate biosynthetic process
GO:0009152	0.925	purine ribonucleotide biosynthetic process
GO:0071616	0.920	acyl-CoA biosynthetic process
GO:0035337	0.918	fatty-acyl-CoA metabolic process
GO:0008610	0.836	lipid biosynthetic process
GO:1901570	0.481	fatty acid derivative biosynthetic process
GO:0009056	0.375	catabolic process
GO:0044242	0.359	cellular lipid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005739	0.773	mitochondrion
GO:0016020	0.337	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15421	1.000	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	1.000	long-chain-fatty-acid--CoA ligase.
EC:3.1.-.-	0.998	Acting on ester bonds.
RHEA:16781	0.992	a fatty acyl-CoA + H2O = a fatty acid + CoA + H(+)
EC:3.1.2.20	0.992	acyl-CoA hydrolase.
EC:2.-.-.-	0.398	Transferases.

[back to server]