StarFunc result for job id Q5FWE3

User Input

>input (981 residues)
MASSPWGCVCGLLLLLLPLLGTGPALGRGFPRPLENSEIPMIPGAHPKGSVGSEPQAFDV
FPENPRADSHRNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQ
GPSSHGWTGPLDSQELLQQEAVAPHPVGHPHLTFIPTTPRRQLRVATVPPSLQHEGQEGQ
WPPRDEGLKAKTKSRVPPTSPSDHQGPPHTLVSHSGTVKRPVLEGQGGFEEHLQEAAQGP
HFTQQDPAAPDVGSVPPVEVVYSQEPGAQPDLALARSLPPAEELPVETPKRAGAEVSWEV
SSPGPPPKQADLPDAKDSPGPQPTDPPASEAPDRPSKPERAAMNGADPISPQRVRGAVEA
PGTPKSLIPGPSDPGPAVNRTESPMGALQPDEAEEWPGRPQSHPPAPPVQAPSTSRRGLI
RVTTQRALGQPPPPEPTASSMASAPASSPPANATAPPLRWGPLRRVLSFSWELHVYGVGV
LFLLPALLALAALAAAPAGPRLALVAAVLVLVASALRSAYMLTDPYGSQARLGVRGGLVL
YNLPFPLLLTALAALTLLGLGAGLPPPLQNPLLLGAVALVHGVGLLATDLLSTWSVLNLL
TQGLSCAWGAAVALGTLCLCRRRLLDGPRGWDASPGPRLLAVAGALGLLASGLQLAAALW
LYPGPGRVGRFSWAWWGVHFWLRLLELTWALALALAAVAAARPRPPTEHACWAKLMRLAC
PAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGR
GPQGGPGLSRNGVGPAPSLSELDLRPPSPINLSRSIDAALFREHLVRDSVFQRCGLRGLA
SPPPGGALRPRRGSHPKAELDDAGSSLLRGRCRSLSDVRVRGPVPQHVVEAPDGAAAAAS
GSSLDSFSRGSLKISWNPWRHGLSSVDSLPLDELPSTVQLLPAPTPAPDSTAARQGDGQG
EVQPRGKPGESRSASSDTIEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q587H5	0.062	0.052	1.418E-3	1501	0.162	0.106	Q587H5.pdb.gz	Q587H5_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.160 PE=4 SV=1
2	AFDB:O60721	0.071	0.065	3.732E-3	1099	0.143	0.127	O60721.pdb.gz	NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC24A1 PE=1 SV=1
3	AFDB:F4HW65	0.051	0.048	6.326E-3	1116	0.161	0.142	F4HW65.pdb.gz	STIL1_ARATH Protein STICHEL-like 1 OS=Arabidopsis thaliana OX=3702 GN=At1g14460 PE=1 SV=1
4	PDB:7td1R	0.167	0.420	1.863E-2	293	0.036	0.119	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
5	AFDB:M9NGP0	0.041	0.048	1.985E-2	790	0.130	0.162	M9NGP0.pdb.gz	M9NGP0_DROME Mnt, isoform I OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
6	AFDB:Q9VL32	0.060	0.036	2.584E-2	2171	0.128	0.058	Q9VL32.pdb.gz	SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster OX=7227 GN=Sur PE=1 SV=4
7	AFDB:O35927	0.072	0.064	2.822E-2	1247	0.167	0.132	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
8	PDB:7vv6R	0.170	0.483	3.159E-2	271	0.039	0.140	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
9	PDB:6gdgA	0.169	0.501	3.301E-2	264	0.033	0.121	6gdgA.pdb.gz	Cryo-EM structure of the adenosine A2Areceptor coupled to an engineered heterotrimeric G protein.
10	AFDB:Q9XEK5	0.057	0.055	4.999E-2	1035	0.140	0.132	Q9XEK5.pdb.gz	Q9XEK5_CHLRE Gamete-specific homeodomain protein OS=Chlamydomonas reinhardtii OX=3055 GN=gsp1 PE=1 SV=3
11	PDB:7f53R	0.163	0.432	5.354E-2	273	0.034	0.121	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
12	PDB:7yu4A	0.151	0.426	5.354E-2	266	0.036	0.132	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
13	PDB:6ibbA	0.159	0.394	5.846E-2	301	0.028	0.090	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
14	AFDB:A0A0B4LFI1	0.068	0.064	5.960E-2	1089	0.127	0.115	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
15	AFDB:P53094	0.049	0.037	5.960E-2	1487	0.134	0.088	P53094.pdb.gz	MDS3_YEAST Negative regulator of sporulation MDS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDS3 PE=1 SV=2
16	AFDB:B0M0P8	0.069	0.038	6.508E-2	2356	0.119	0.050	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
17	PDB:7qa8B	0.166	0.413	8.312E-2	299	0.045	0.147	7qa8B.pdb.gz	Activation mechanism of the class D fungal GPCR dimer Ste2.
18	PDB:7wz4R	0.161	0.516	9.076E-2	233	0.044	0.185	7wz4R.pdb.gz
19	PDB:6wwzR	0.179	0.439	9.484E-2	310	0.038	0.119	6wwzR.pdb.gz
20	PDB:8dwcR	0.174	0.539	9.484E-2	250	0.041	0.160	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZUN3	2.36e-04	47.8	35375	0.093	0.003	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
2	G4SLH0	2.69e-04	47.8	18562	0.049	0.003	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
3	A2ASS6	0.11	39.3	35213	0.081	0.002	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354947	0.711	F-actin-capping protein subunit alpha-2
2	9606.ENSP00000443654	0.679	Carabin
3	9606.ENSP00000351395	0.664	Secretoglobin family 1D member 4
4	9606.ENSP00000303686	0.642	Neurotensin receptor type 2
5	9606.ENSP00000297873	0.633	Methyltransferase-like protein 27
6	9606.ENSP00000296280	0.632	Mannan binding lectin serine peptidase 1
7	9606.ENSP00000327214	0.625	Cation-transporting ATPase 13A2
8	9606.ENSP00000339182	0.625	Probable cation-transporting ATPase 13A4
9	9606.ENSP00000341942	0.625	Probable cation-transporting ATPase 13A5
10	9606.ENSP00000416508	0.625	Probable cation-transporting ATPase 13A3
11	9606.ENSP00000429608	0.613	FANCD2 opposite strand
12	9606.ENSP00000287652	0.546	Putative deoxyribonuclease TATDN2
13	9606.ENSP00000307208	0.528	Nucleosome-remodeling factor subunit BPTF
14	9606.ENSP00000287585	0.524	LHFPL tetraspan subfamily member 4
15	9606.ENSP00000345633	0.520	Zinc finger CCHC-type containing 13
16	9606.ENSP00000439378	0.518	Protein SSUH2 homolog
17	9606.ENSP00000373343	0.513	Copine-9
18	9606.ENSP00000339532	0.503	THUMP domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.958	biological regulation
GO:0050794	0.859	regulation of cellular process
GO:0050896	0.550	response to stimulus
GO:0051716	0.323	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0071944	0.990	cell periphery
GO:0005886	0.968	plasma membrane
GO:0005576	0.959	extracellular region
GO:0043226	0.900	organelle
GO:0043229	0.869	intracellular organelle
GO:0005737	0.814	cytoplasm
GO:0005615	0.709	extracellular space
GO:0043227	0.678	membrane-bounded organelle
GO:0031982	0.446	vesicle
GO:0070062	0.395	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]