StarFunc result for job id Q5FWF5

User Input

>input (840 residues)
MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQP
ELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNR
RSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVL
EVKSDSKEDENLVINEVINSPKGKKRKVEHQTACACSSQCTQGSEKCPQKTTRRDETKPV
PVTSEVKRSKMATSVVPKKNEMKKSVHTQVNTNTTLPKSPQPSVPEQSDNELEQAGKSKR
GSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQILHQKETNQDV
QCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRT
SFSPPALEMHHPVTQSTFLGTKLHDRNITCQQEKMKEINSEEVKINDITVEINKTTERAP
ENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKI
DTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKT
DEKQLIIDAGQKRFGAVSCNVCGMLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILA
EYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVG
CLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRR
KKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FWF5	0.999	0.999	0.000	840	1.000	1.000	Q5FWF5.pdb.gz	ESCO1_HUMAN N-acetyltransferase ESCO1 OS=Homo sapiens OX=9606 GN=ESCO1 PE=1 SV=3
2	PDB:4e8oB	0.098	0.453	2.594E-3	148	0.030	0.169	4e8oB.pdb.gz
3	PDB:1s5kA	0.105	0.483	5.062E-3	153	0.027	0.150	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
4	PDB:1qsmD	0.095	0.441	5.380E-3	152	0.012	0.066	1qsmD.pdb.gz	Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
5	PDB:4ua3B	0.090	0.339	1.050E-2	194	0.018	0.077	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
6	PDB:5c88A	0.091	0.382	1.116E-2	158	0.026	0.139	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
7	PDB:2zpaB	0.091	0.111	2.315E-2	662	0.024	0.030	2zpaB.pdb.gz	RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon
8	PDB:6c95B	0.076	0.323	2.614E-2	161	0.020	0.106	6c95B.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
9	PDB:4evyA	0.082	0.385	3.543E-2	147	0.024	0.136	4evyA.pdb.gz	Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
10	PDB:7vvuP	0.128	0.331	4.518E-2	270	0.020	0.063	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
11	PDB:1yleA	0.070	0.161	5.102E-2	330	0.013	0.033	1yleA.pdb.gz	The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
12	AFDB:F4HQ88	0.059	0.048	6.869E-2	1169	0.142	0.102	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
13	AFDB:Q14004	0.060	0.039	9.893E-2	1512	0.112	0.062	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
14	AFDB:Q5QJE6	0.055	0.059	1.817E-1	756	0.131	0.146	Q5QJE6.pdb.gz	TDIF2_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2
15	AFDB:Q586D9	0.043	0.027	1.931E-1	2060	0.105	0.043	Q586D9.pdb.gz	Q586D9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.170 PE=4 SV=1
16	AFDB:Q6FN53	0.069	0.065	2.617E-1	915	0.110	0.101	Q6FN53.pdb.gz	STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE20 PE=3 SV=1
17	AFDB:Q9VI93	0.051	0.047	3.141E-1	946	0.080	0.071	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
18	AFDB:Q583D6	0.058	0.044	3.338E-1	1471	0.138	0.079	Q583D6.pdb.gz	Q583D6_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.880 PE=3 SV=1
19	AFDB:D6RAA5	0.046	0.042	3.547E-1	1008	0.150	0.125	D6RAA5.pdb.gz	D6RAA5_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
20	AFDB:O62486	0.051	0.050	3.547E-1	871	0.121	0.117	O62486.pdb.gz	O62486_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FWF5	0.0	1726	840	1.000	1.000	ESCO1_HUMAN N-acetyltransferase ESCO1 OS=Homo sapiens OX=9606 GN=ESCO1 PE=1 SV=3
2	Q5SPR8	4.10e-99	323	609	0.162	0.223	ESCO2_DANRE N-acetyltransferase ESCO2 OS=Danio rerio OX=7955 GN=esco2 PE=2 SV=1
3	Q56NI9	6.27e-99	322	601	0.169	0.236	ESCO2_HUMAN N-acetyltransferase ESCO2 OS=Homo sapiens OX=9606 GN=ESCO2 PE=1 SV=1
4	Q8CIB9	5.40e-96	314	592	0.167	0.236	ESCO2_MOUSE N-acetyltransferase ESCO2 OS=Mus musculus OX=10090 GN=Esco2 PE=1 SV=3
5	H0YB88	1.06e-34	132	176	0.067	0.318	H0YB88_HUMAN Establishment of sister chromatid cohesion N-acetyltransferase 2 (Fragment) OS=Homo sapiens OX=9606 GN=ESCO2 PE=1 SV=1
6	Q9VS50	2.13e-34	144	1052	0.096	0.077	ECO_DROME N-acetyltransferase eco OS=Drosophila melanogaster OX=7227 GN=eco PE=1 SV=1
7	A7UL74	1.58e-24	108	345	0.090	0.220	CTF7_ARATH Protein CHROMOSOME TRANSMISSION FIDELITY 7 OS=Arabidopsis thaliana OX=3702 GN=CTF7 PE=1 SV=1
8	O42917	4.33e-17	88.6	872	0.080	0.077	ESO1_SCHPO N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eso1 PE=1 SV=1
9	P43605	5.09e-11	66.6	281	0.055	0.164	ECO1_YEAST N-acetyltransferase ECO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECO1 PE=1 SV=1
10	Q4GZ53	4.33e-09	60.8	295	0.031	0.088	Q4GZ53_TRYB2 N-acetyltransferase ESCO acetyl-transferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1660 PE=4 SV=1
11	P18490	1.1	35.4	3413	0.057	0.014	PCX_DROME Protein pecanex OS=Drosophila melanogaster OX=7227 GN=pcx PE=2 SV=4
12	Q8WZ42	8.7	32.7	34350	0.029	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13880 Acetyltransf_13	5.8e-26	101.5	ESCO1/2 acetyl-transferase
2	PF13878 zf-C2H2_3	6.7e-12	56.3	zinc-finger of acetyl-transferase ESCO

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303427	0.998	Sister chromatid cohesion protein PDS5 homolog A
2	9606.ENSP00000354720	0.998	Structural maintenance of chromosomes protein 3
3	9606.ENSP00000297338	0.992	Double-strand-break repair protein rad21 homolog
4	9606.ENSP00000313851	0.991	Sister chromatid cohesion protein PDS5 homolog B
5	9606.ENSP00000298767	0.989	Wings apart-like protein homolog
6	9606.ENSP00000323421	0.984	Structural maintenance of chromosomes protein 1A
7	9606.ENSP00000372689	0.979	Cohesin subunit SA-1
8	9606.ENSP00000218089	0.975	Cohesin subunit SA-2
9	9606.ENSP00000262315	0.972	Chromosome transmission fidelity protein 18 homolog
10	9606.ENSP00000282516	0.913	Nipped-B-like protein
11	9606.ENSP00000440402	0.875	ATP-dependent DNA helicase DDX11
12	9606.ENSP00000257934	0.874	Separin
13	9606.ENSP00000262815	0.869	MAU2 chromatid cohesion factor homolog
14	9606.ENSP00000322180	0.867	Sister chromatid cohesion protein DCC1
15	9606.ENSP00000383042	0.865	Lysine-specific histone demethylase 1A
16	9606.ENSP00000353793	0.861	WD repeat and HMG-box DNA-binding protein 1
17	9606.ENSP00000368458	0.843	Proliferating cell nuclear antigen
18	9606.ENSP00000354957	0.836	Structural maintenance of chromosomes protein 5
19	9606.ENSP00000275517	0.823	Sororin
20	9606.ENSP00000404092	0.819	Structural maintenance of chromosomes protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0008270	1.000	zinc ion binding
GO:0061733	1.000	peptide-lysine-N-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0006275	0.982	regulation of DNA replication
GO:0019538	0.977	protein metabolic process
GO:0043412	0.967	macromolecule modification
GO:0036211	0.963	protein modification process
GO:0018193	0.951	peptidyl-amino acid modification
GO:0006473	0.933	protein acetylation
GO:0018205	0.931	peptidyl-lysine modification
GO:0043687	0.930	post-translational protein modification
GO:0018394	0.846	peptidyl-lysine acetylation
GO:0009987	0.643	cellular process
GO:0071840	0.315	cellular component organization or biogenesis
GO:0016043	0.312	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000785	0.999	chromatin
GO:0005737	0.894	cytoplasm
GO:0032991	0.762	protein-containing complex
GO:0005829	0.376	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]