StarFunc result for job id Q5FWF6

User Input

>input (425 residues)
MFPPARGKELLSFEDVAMYFTREEWGHLNWGQKDLYRDVMLENYRNMVLLGFQFPKPEMI
CQLENWDEQWILDLPRTGNRKASGSACPGSEARHKMKKLTPKQKFSEDLESYKISVVMQE
SAEKLSEKLHKCKEFVDSCRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGK
PFNQRSLLLGHERILTRAKSYECSECGKVIRRKAWFDQHQRIHFLENPFECKVCGQAFRQ
RSALTVHKQCHLQNKPYRCHDCGKCFRQLAYLVEHKRIHTKEKPYKCSKCEKTFSQNSTL
IRHQVIHSGEKRHKCLECGKAFGRHSTLLCHQQIHSKPNTHKCSECGQSFGRNVDLIQHQ
RIHTKEEFFQCGECGKTFSFKRNLFRHQVIHTGSQPYQCVICGKSFKWHTSFIKHQGTHK
GQIST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FWF6	1.000	1.000	9.591E-71	425	1.000	1.000	Q5FWF6.pdb.gz	ZN789_HUMAN Zinc finger protein 789 OS=Homo sapiens OX=9606 GN=ZNF789 PE=1 SV=3
2	AFDB:Q05481	0.335	0.131	1.269E-31	1191	0.381	0.136	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
3	AFDB:Q96JC4	0.332	0.273	1.269E-31	524	0.402	0.326	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
4	AFDB:Q9H8G1	0.334	0.255	1.342E-31	570	0.388	0.289	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
5	AFDB:Q8NCK3	0.305	0.295	7.962E-31	441	0.358	0.345	Q8NCK3.pdb.gz	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
6	AFDB:Q14593	0.334	0.254	9.409E-31	569	0.365	0.272	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
7	AFDB:A0A1Y7VIZ1	0.331	0.303	1.175E-30	466	0.358	0.326	A0A1Y7VIZ1.pdb.gz	A0A1Y7VIZ1_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
8	AFDB:Q03923	0.339	0.248	1.389E-30	595	0.376	0.269	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	AFDB:Q86Y25	0.337	0.262	2.050E-30	554	0.379	0.291	Q86Y25.pdb.gz	Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens OX=9606 GN=ZNF354C PE=1 SV=1
10	AFDB:Q8IYN0	0.336	0.268	2.050E-30	542	0.358	0.280	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
11	PDB:3w5kB	0.107	0.270	1.090E-3	110	0.085	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.047	0.222	6.553E-1	62	0.035	0.242	6ydhA.pdb.gz
13	PDB:7o4iW	0.066	0.080	1.208	312	0.056	0.077	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:5dkaA	0.073	0.242	1.278	96	0.035	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7uhyD	0.084	0.108	1.687	288	0.096	0.142	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:5apnp	0.057	0.169	1.994	91	0.042	0.198	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
17	PDB:5n5yI	0.043	0.126	2.356	99	0.049	0.212	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:4kblA	0.062	0.066	2.491	395	0.075	0.081	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
19	PDB:7qp6y	0.084	0.063	2.491	697	0.092	0.056	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
20	PDB:4c2mI	0.052	0.112	2.784	124	0.056	0.194	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FWF6	0.0	886	425	1.000	1.000	ZN789_HUMAN Zinc finger protein 789 OS=Homo sapiens OX=9606 GN=ZNF789 PE=1 SV=3
2	Q3KNS6	5.33e-98	301	432	0.409	0.403	ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens OX=9606 GN=ZNF829 PE=1 SV=1
3	Q8NCK3	6.74e-97	299	441	0.402	0.388	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
4	Q6PCX8	1.01e-96	304	632	0.431	0.290	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
5	Q3USU9	1.02e-96	304	632	0.431	0.290	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
6	Q3V362	5.39e-96	302	622	0.428	0.293	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
7	Q6ZNG0	8.78e-95	293	422	0.376	0.379	ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens OX=9606 GN=ZNF620 PE=1 SV=1
8	A0A0C4DG42	2.41e-94	295	539	0.414	0.327	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
9	Q8IZ26	2.81e-94	296	560	0.414	0.314	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
10	P17036	3.46e-94	292	446	0.381	0.363	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
11	Q86U76	4.18e-94	291	410	0.381	0.395	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
12	Q9BSG1	2.35e-92	286	425	0.376	0.376	ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens OX=9606 GN=ZNF2 PE=1 SV=5
13	P15622	4.05e-92	290	560	0.426	0.323	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
14	Q5JVG8	9.97e-92	286	444	0.386	0.369	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
15	Q2NKJ9	1.51e-91	289	569	0.388	0.290	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
16	Q8N9F8	1.54e-91	288	522	0.409	0.333	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
17	Q9P2J8	5.95e-91	295	865	0.421	0.207	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
18	Q9BRH9	9.61e-91	290	671	0.402	0.255	ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens OX=9606 GN=ZNF251 PE=1 SV=4
19	Q9C0F3	1.31e-90	283	470	0.393	0.355	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
20	Q03923	1.61e-90	287	595	0.386	0.276	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	2.5e+02	13.1	Double zinc ribbon
2	PF01352 KRAB	1.4e-18	77.5	KRAB box
3	PF00096 zf-C2H2	4.4e-30	113.6	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	2.7e+02	12.8	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	1.8e-11	54.8	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.22	22.8	C2H2-type zinc finger
7	PF15909 zf-C2H2_8	0.19	23.4	C2H2-type zinc ribbon
8	PF13465 zf-H2C2_2	1.2e-31	118.9	Zinc-finger double domain
9	PF18439 zf_UBZ	64	14.6	Ubiquitin-Binding Zinc Finger
10	PF09723 Zn-ribbon_8	0.12	23.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411372	0.594	Protein FAM200A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.653	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0010556	0.970	regulation of macromolecule biosynthetic process
GO:0051252	0.920	regulation of RNA metabolic process
GO:0010468	0.914	regulation of gene expression
GO:0048519	0.905	negative regulation of biological process
GO:0009987	0.900	cellular process
GO:0031326	0.898	regulation of cellular biosynthetic process
GO:0009892	0.893	negative regulation of metabolic process
GO:0051172	0.879	negative regulation of nitrogen compound metabolic process
GO:0010605	0.868	negative regulation of macromolecule metabolic process
GO:0048523	0.865	negative regulation of cellular process
GO:2001141	0.860	regulation of RNA biosynthetic process
GO:0006355	0.826	regulation of DNA-templated transcription
GO:0008152	0.821	metabolic process
GO:0071704	0.786	organic substance metabolic process
GO:0031324	0.772	negative regulation of cellular metabolic process
GO:0044238	0.706	primary metabolic process
GO:0044237	0.703	cellular metabolic process
GO:0045934	0.622	negative regulation of nucleobase-containing compound metabolic process
GO:0006807	0.578	nitrogen compound metabolic process
GO:0009890	0.470	negative regulation of biosynthetic process
GO:0051253	0.455	negative regulation of RNA metabolic process
GO:0031327	0.423	negative regulation of cellular biosynthetic process
GO:0010558	0.419	negative regulation of macromolecule biosynthetic process
GO:0043170	0.374	macromolecule metabolic process
GO:0006725	0.357	cellular aromatic compound metabolic process
GO:1902679	0.353	negative regulation of RNA biosynthetic process
GO:1901360	0.345	organic cyclic compound metabolic process
GO:0006139	0.342	nucleobase-containing compound metabolic process
GO:0045892	0.341	negative regulation of DNA-templated transcription
GO:0071840	0.340	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0016020	0.375	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]