StarFunc result for job id Q5FWF7

User Input

>input (155 residues)
MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASL
TCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLS
GRYSNICSPISLPEKIMYPMDADTWGEILEAELER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FWF7	1.000	1.000	3.163E-23	155	1.000	1.000	Q5FWF7.pdb.gz	FBX48_HUMAN F-box only protein 48 OS=Homo sapiens OX=9606 GN=FBXO48 PE=1 SV=1
2	AFDB:P87060	0.425	0.108	1.383E-2	775	0.219	0.044	P87060.pdb.gz	POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop1 PE=1 SV=1
3	AFDB:Q94251	0.357	0.072	5.444E-2	936	0.142	0.024	Q94251.pdb.gz	DRE1_CAEEL F-box protein dre-1 OS=Caenorhabditis elegans OX=6239 GN=dre-1 PE=1 SV=3
4	AFDB:Q8N3Y1	0.362	0.112	6.417E-2	598	0.142	0.037	Q8N3Y1.pdb.gz	FBXW8_HUMAN F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=2
5	AFDB:Q96IG2	0.269	0.102	7.990E-2	436	0.123	0.044	Q96IG2.pdb.gz	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
6	AFDB:Q9VH60	0.281	0.040	8.441E-2	1182	0.129	0.017	Q9VH60.pdb.gz	Q9VH60_DROME F-box protein 11, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXO11 PE=4 SV=1
7	AFDB:Q7TPD1	0.287	0.054	8.916E-2	930	0.148	0.025	Q7TPD1.pdb.gz	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
8	AFDB:Q54DE4	0.394	0.133	1.051E-1	530	0.168	0.049	Q54DE4.pdb.gz	Q54DE4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292312 PE=4 SV=1
9	AFDB:A8DYA6	0.263	0.064	1.173E-1	651	0.129	0.031	A8DYA6.pdb.gz	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
10	AFDB:Q8BIA4	0.421	0.134	1.173E-1	598	0.161	0.042	Q8BIA4.pdb.gz	FBXW8_MOUSE F-box/WD repeat-containing protein 8 OS=Mus musculus OX=10090 GN=Fbxw8 PE=1 SV=2
11	PDB:6o60C	0.237	0.096	3.289E-1	389	0.103	0.041	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
12	PDB:7b5mT	0.235	0.114	7.485E-1	325	0.090	0.043	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
13	PDB:7z8bF	0.337	0.129	7.485E-1	457	0.110	0.037	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
14	PDB:7sa1B	0.200	0.052	1.368	624	0.084	0.021	7sa1B.pdb.gz
15	PDB:2p1nB	0.203	0.057	2.641	571	0.065	0.018	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
16	PDB:7wooD	0.164	0.035	2.947	1398	0.084	0.009	7wooD.pdb.gz
17	PDB:7pmkL	0.235	0.084	3.876	475	0.097	0.032	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7fikP	0.175	0.064	4.826	593	0.129	0.034	7fikP.pdb.gz
19	PDB:4jdqA	0.159	0.221	5.386	102	0.097	0.147	4jdqA.pdb.gz
20	PDB:4v1nM	0.142	0.101	7.084	299	0.155	0.080	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FWF7	3.03e-114	322	155	1.000	1.000	FBX48_HUMAN F-box only protein 48 OS=Homo sapiens OX=9606 GN=FBXO48 PE=1 SV=1
2	P87053	3.01e-05	45.1	605	0.129	0.033	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
3	P39014	9.33e-05	43.5	640	0.123	0.030	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1
4	Q9UKT8	9.71e-05	43.5	454	0.135	0.046	FBXW2_HUMAN F-box/WD repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=FBXW2 PE=1 SV=2
5	Q60584	1.52e-04	42.7	422	0.135	0.050	FBXW2_MOUSE F-box/WD repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Fbxw2 PE=2 SV=2
6	Q9VZF4	5.97e-04	41.2	1326	0.129	0.015	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
7	P34284	0.001	40.4	466	0.097	0.032	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
8	Q7TSL3	0.001	40.0	843	0.219	0.040	FBX11_RAT F-box only protein 11 OS=Rattus norvegicus OX=10116 GN=Fbxo11 PE=2 SV=1
9	Q86NX0	0.001	40.4	391	0.116	0.046	Q86NX0_DROME GM10337p (Fragment) OS=Drosophila melanogaster OX=7227 GN=morgue PE=2 SV=1
10	Q9Y165	0.001	40.4	491	0.116	0.037	Q9Y165_DROME BcDNA.GH02435 OS=Drosophila melanogaster OX=7227 GN=morgue PE=1 SV=1
11	A0A0B4KEK4	0.002	39.7	455	0.135	0.046	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
12	A0A0B4KEU4	0.002	39.7	497	0.135	0.042	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
13	A1Z8M8	0.002	39.3	464	0.097	0.032	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
14	Q5BI22	0.002	39.7	437	0.135	0.048	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
15	Q7TPD1	0.002	40.0	930	0.219	0.037	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
16	Q86XK2	0.002	40.0	927	0.219	0.037	FBX11_HUMAN F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11 PE=1 SV=3
17	Q9P7W4	0.002	39.7	662	0.200	0.047	POF10_SCHPO F-box/WD repeat-containing protein pof10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof10 PE=1 SV=1
18	A8DYA5	0.003	39.3	426	0.097	0.035	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
19	A8DYA6	0.003	39.3	651	0.097	0.023	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
20	B7ZDC8	0.003	38.9	544	0.116	0.033	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.00026	32.0	F-box domain
2	PF12937 F-box-like	1.8e-09	48.6	F-box-like
3	PF15966 F-box_4	1e+02	14.2	F-box
4	PF04540 Herpes_UL51	5.4e+02	11.7	Herpesvirus UL51 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367193

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272342	0.768	Ewing's tumor-associated antigen 1
2	9606.ENSP00000263657	0.662	RNA-binding protein PNO1
3	9606.ENSP00000361544	0.662	Nucleoporin-62 C-terminal-like protein
4	9606.ENSP00000485212	0.657	Olfactory receptor 8B4
5	9606.ENSP00000396402	0.648	Zinc finger protein 793
6	9606.ENSP00000295121	0.642	Uncharacterized protein DKFZp434B156
7	9606.ENSP00000307004	0.642	Aprataxin and PNK-like factor
8	9606.ENSP00000296824	0.637	Coiled-coil domain containing 127
9	9606.ENSP00000315664	0.636	Zinc finger protein 18
10	9606.ENSP00000263655	0.632	CB1 cannabinoid receptor-interacting protein 1
11	9606.ENSP00000361784	0.607	Zinc finger protein 684
12	9606.ENSP00000303111	0.603	Olfactory receptor 5AP2
13	9606.ENSP00000306607	0.601	Olfactory receptor 1L8
14	9606.ENSP00000484875	0.600	Forkhead box D4 like 6
15	9606.ENSP00000375248	0.571	Class A basic helix-loop-helix protein 9
16	9606.ENSP00000436424	0.570	Olfactory receptor 4D10
17	9606.ENSP00000423897	0.553	Kelch-like protein 5
18	9606.ENSP00000375586	0.544	Zinc finger protein 304
19	9606.ENSP00000270642	0.524	IgLON family member 5
20	9606.ENSP00000437616	0.515	Zinc finger protein 611

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0009057	0.985	macromolecule catabolic process
GO:0065007	0.982	biological regulation
GO:0006511	0.976	ubiquitin-dependent protein catabolic process
GO:0050789	0.968	regulation of biological process
GO:0050794	0.871	regulation of cellular process
GO:0050896	0.548	response to stimulus
GO:0019222	0.432	regulation of metabolic process
GO:0060255	0.423	regulation of macromolecule metabolic process
GO:0048518	0.399	positive regulation of biological process
GO:0080090	0.364	regulation of primary metabolic process
GO:0051171	0.361	regulation of nitrogen compound metabolic process
GO:0048522	0.358	positive regulation of cellular process
GO:0031323	0.355	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.957	cytosol
GO:0032991	0.954	protein-containing complex
GO:0000151	0.838	ubiquitin ligase complex
GO:0005634	0.818	nucleus
GO:0031461	0.795	cullin-RING ubiquitin ligase complex
GO:0019005	0.732	SCF ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]