StarFunc result for job id Q5GLZ8

User Input

>input (1057 residues)
MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGC
NDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVG
SEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTS
PQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLR
SQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTEIA
CGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNGQCLPDIDSEE
YFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPV
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQ
QVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAP
LKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEIL
HRVNEKMGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICT
YPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVG
DAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSR
LIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPD
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY
VDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKG
EYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLP
VSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5GLZ8	1.000	1.000	0.000	1057	1.000	1.000	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
2	AFDB:E8NHA2	0.880	0.876	1.106E-99	1062	0.451	0.449	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
3	AFDB:Q8IVU3	0.828	0.855	8.609E-81	1022	0.356	0.368	Q8IVU3.pdb.gz	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
4	AFDB:Q9UII4	0.734	0.754	2.619E-76	1024	0.338	0.349	Q9UII4.pdb.gz	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
5	AFDB:F2Z461	0.794	0.833	4.086E-75	1003	0.341	0.359	F2Z461.pdb.gz	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
6	AFDB:Q5U5R9	0.534	0.712	3.903E-40	776	0.206	0.281	Q5U5R9.pdb.gz	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
7	AFDB:Q05086	0.532	0.635	2.183E-37	875	0.194	0.234	Q05086.pdb.gz	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
8	AFDB:Q9VTH1	0.550	0.595	2.183E-37	973	0.200	0.217	Q9VTH1.pdb.gz	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
9	AFDB:O94275	0.533	0.688	2.067E-36	807	0.180	0.235	O94275.pdb.gz	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
10	AFDB:P40985	0.520	0.611	6.360E-36	892	0.170	0.202	P40985.pdb.gz	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
11	PDB:8gqeB	0.303	0.815	2.901E-25	386	0.117	0.321	8gqeB.pdb.gz
12	PDB:5xgsA	0.318	0.818	9.323E-22	398	0.109	0.289	5xgsA.pdb.gz
13	PDB:5tbkI	0.311	0.764	1.972E-21	419	0.098	0.248	5tbkI.pdb.gz
14	PDB:7jq9A	0.236	0.113	4.928E-21	2427	0.132	0.057	7jq9A.pdb.gz
15	PDB:7mopA	0.233	0.110	8.121E-21	2445	0.132	0.057	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
16	PDB:5t94A	0.311	0.706	9.080E-20	454	0.096	0.222	5t94A.pdb.gz
17	PDB:4d4oA	0.272	0.665	1.033E-13	414	0.069	0.176	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
18	PDB:7mq8LR	0.164	0.214	1.209E-6	773	0.062	0.085	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7d5sB2	0.189	0.229	2.165E-6	851	0.045	0.056	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:7r5jD4	0.174	0.145	4.393E-6	1312	0.109	0.088	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E8NHA2	0.0	902	1062	0.458	0.456	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
2	F2Z461	0.0	621	1003	0.356	0.375	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
3	Q5GLZ8	0.0	2190	1057	1.000	1.000	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
4	Q6PAV2	0.0	2131	1057	0.968	0.968	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
5	Q8IVU3	0.0	656	1022	0.375	0.387	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
6	Q9UII4	0.0	639	1024	0.340	0.351	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
7	D6RCL5	3.68e-145	435	240	0.204	0.900	D6RCL5_HUMAN HECT and RLD domain containing E3 ubiquitin protein ligase 4 (Fragment) OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
8	Q5U5R9	1.53e-88	303	776	0.186	0.254	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
9	F1M7B8	2.26e-86	300	868	0.160	0.195	F1M7B8_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
10	O08759	2.39e-86	300	870	0.159	0.193	UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus OX=10090 GN=Ube3a PE=1 SV=2
11	A0A8I5ZM14	2.58e-86	299	867	0.160	0.195	A0A8I5ZM14_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=1
12	Q05086	3.64e-86	299	875	0.158	0.191	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
13	Q9VTH1	1.96e-73	265	973	0.155	0.169	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
14	O94275	8.73e-73	260	807	0.151	0.198	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
15	P40985	9.27e-60	223	892	0.145	0.172	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
16	Q9FN03	1.52e-58	210	440	0.115	0.277	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
17	A0A0G2JTH7	1.89e-56	211	760	0.122	0.170	A0A0G2JTH7_RAT Ubiquitin protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
18	O14326	2.87e-56	211	786	0.115	0.155	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
19	Q9UTG2	1.14e-51	196	671	0.114	0.180	PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub2 PE=1 SV=1
20	Q5BDP1	4.39e-51	196	821	0.116	0.150	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	2.5e-84	294.9	HECT-domain (ubiquitin-transferase)
2	PF19256 LAIKA	3.7e+02	12.3	LAIKA domain
3	PF00415 RCC1	3.3e-87	298.2	Regulator of chromosome condensation (RCC1) repeat
4	PF13540 RCC1_2	4.6e-43	155.4	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378624

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478783	0.787	E3 ubiquitin-protein ligase listerin
2	9606.ENSP00000273968	0.764	Protein preY, mitochondrial
3	9606.ENSP00000351790	0.698	Myopalladin
4	9606.ENSP00000404121	0.685	Interleukin enhancer-binding factor 3
5	9606.ENSP00000467579	0.674	WW domain-binding protein 2
6	9606.ENSP00000229268	0.672	Ubiquitin carboxyl-terminal hydrolase 5
7	9606.ENSP00000369299	0.645	E3 ubiquitin-protein ligase TRIM22
8	9606.ENSP00000212015	0.636	NAD-dependent protein deacetylase sirtuin-1
9	9606.ENSP00000252593	0.635	Bone marrow stromal antigen 2
10	9606.ENSP00000318804	0.631	Cytokine receptor-like factor 3
11	9606.ENSP00000350386	0.625	Rab proteins geranylgeranyltransferase component A 1
12	9606.ENSP00000355511	0.625	Rab proteins geranylgeranyltransferase component A 2
13	9606.ENSP00000321239	0.619	RING finger and CHY zinc finger domain-containing protein 1
14	9606.ENSP00000372361	0.613	Zinc finger MYM-type protein 5
15	9606.ENSP00000381601	0.608	Interferon-induced GTP-binding protein Mx1
16	9606.ENSP00000320563	0.606	WD repeat- and FYVE domain-containing protein 4
17	9606.ENSP00000451261	0.587	Ubiquitin-conjugating enzyme E2 J1
18	9606.ENSP00000431391	0.578	Apoptosis inhibitor 5
19	9606.ENSP00000323580	0.577	Intraflagellar transport protein 88 homolog
20	9606.ENSP00000381717	0.575	Ubiquitin-conjugating enzyme E2 D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0097159	0.404	organic cyclic compound binding
GO:1901363	0.401	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0006807	0.956	nitrogen compound metabolic process
GO:0043170	0.927	macromolecule metabolic process
GO:0019538	0.923	protein metabolic process
GO:0016567	0.906	protein ubiquitination
GO:0048519	0.808	negative regulation of biological process
GO:0009987	0.796	cellular process
GO:0032501	0.793	multicellular organismal process
GO:0032502	0.789	developmental process
GO:0048523	0.783	negative regulation of cellular process
GO:0048583	0.781	regulation of response to stimulus
GO:0009966	0.723	regulation of signal transduction
GO:0000003	0.622	reproduction
GO:0010648	0.553	negative regulation of cell communication
GO:0008589	0.548	regulation of smoothened signaling pathway
GO:0009968	0.531	negative regulation of signal transduction
GO:0045879	0.471	negative regulation of smoothened signaling pathway
GO:0022414	0.395	reproductive process
GO:0048609	0.380	multicellular organismal reproductive process
GO:0044237	0.351	cellular metabolic process
GO:0019953	0.345	sexual reproduction
GO:0050896	0.316	response to stimulus
GO:0019222	0.301	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031981	1.000	nuclear lumen
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0001650	0.988	fibrillar center
GO:0005654	0.873	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]