StarFunc result for job id Q5H8A4

User Input

>input (983 residues)
MRLGSGTFATCCVAIEVLGIAVFLRGFFPAPVRSSARAEHGAEPPAPEPSAGASSNWTTL
PPPLFSKVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIK
ALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIVFYGDETWVKLFPKHFVEYDGT
TSFFVSDYTEVDNNVTRHLDKVLKRGDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMD
SVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKP
GDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVEGRPMREQLRFLHLNTVQLSK
LLQENVPSYEKDPGFEQFKMSERLHGNWIRLYLEEKHSEVLFNLGSKVLRQYLDALKTLS
LSLSAQVAQYDIYSMMVGTVVVLEVLTLLLLSVPQALRRKAELEVPLSSPGFSLLFYLVI
LVLSAVHVIVCTSAESSCYFCGLSWLAAGGVMVLASALLCVIVSVLTNVLVGGNTPRKNP
MHPSSRWSELDLLILLGTAGHVLSLGASSFVEEEHQTWYFLVNTLCLALSQETYRNYFLG
DDGEPPCGLCVEQGHDGATAAWQDGPGCDVLERDKGHGSPSTSEVLRGREKWMVLASPWL
ILACCRLLRSLNQTGVQWAHRPDLGHWLTSSDHKAELSVLAALSLLVVFVLVQRGCSPVS
KAALALGLLGVYCYRAAIGSVRFPWRPDSKDISKGIIEARFVYVFVLGILFTGTKDLLKS
QVIAADFKLKTVGLWEIYSGLVLLAALLFRPHNLPVLAFSLLIQTLMTKFIWKPLRHDAA
EITVMHYWFGQAFFYFQGNSNNIATVDISAGFVGLDTYVEIPAVLLTAFGTYAGPVLWAS
HLVHFLSSETRSGSALSHACFCYALICSIPVFTYIVLVTSLRYHLFIWSVFSPKLLYEGM
HLLITAAVCVFFTAMDQTRLTQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5H8A4	1.000	1.000	0.000	983	1.000	1.000	Q5H8A4.pdb.gz	PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens OX=9606 GN=PIGG PE=1 SV=1
2	AFDB:Q551Y7	0.771	0.540	1.352E-46	1442	0.284	0.193	Q551Y7.pdb.gz	Q551Y7_DICDI Transmembrane protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276251 PE=4 SV=1
3	AFDB:F4IJJ8	0.757	0.776	2.308E-44	958	0.272	0.279	F4IJJ8.pdb.gz	F4IJJ8_ARATH GPI ethanolamine phosphate transferase 2 OS=Arabidopsis thaliana OX=3702 GN=At2g22530 PE=1 SV=1
4	AFDB:Q9JJI6	0.774	0.701	6.195E-41	1093	0.237	0.213	Q9JJI6.pdb.gz	PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus OX=10090 GN=Pigo PE=1 SV=2
5	AFDB:Q09782	0.634	0.809	3.080E-40	758	0.261	0.339	Q09782.pdb.gz	GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=las21 PE=3 SV=1
6	AFDB:Q8TEQ8	0.734	0.667	3.080E-40	1089	0.242	0.219	Q8TEQ8.pdb.gz	PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens OX=9606 GN=PIGO PE=1 SV=3
7	AFDB:P40367	0.646	0.755	7.935E-36	830	0.221	0.261	P40367.pdb.gz	GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS21 PE=1 SV=1
8	AFDB:O13663	0.729	0.777	6.462E-35	918	0.205	0.220	O13663.pdb.gz	GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi13 PE=3 SV=1
9	AFDB:Q07830	0.704	0.683	1.961E-34	1017	0.202	0.196	Q07830.pdb.gz	GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI13 PE=1 SV=1
10	AFDB:Q385R1	0.637	0.741	2.728E-28	838	0.178	0.209	Q385R1.pdb.gz	Q385R1_TRYB2 GPI ethanolamine phosphate transferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2720 PE=3 SV=1
11	PDB:5venA	0.214	0.511	1.276E-6	382	0.055	0.141	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
12	PDB:2ifyA	0.152	0.276	2.567E-6	508	0.036	0.069	2ifyA.pdb.gz	Structure and Molecular Mechanism of Bacillus anthracis Cofactor-Independent Phosphoglycerate Mutase: A Crucial Enzyme for Spores and Growing Cells of Bacillus Species.
13	PDB:5fqlA	0.198	0.357	5.164E-6	507	0.063	0.122	5fqlA.pdb.gz	Insights into Hunter syndrome from the structure of iduronate-2-sulfatase.
14	PDB:1o98A	0.156	0.284	5.607E-6	509	0.041	0.079	1o98A.pdb.gz	Insights Into the Catalytic Mechanism of Cofactor-Independent Phosphoglycerate Mutase from X-Ray Crystallography, Simulated Dynamics and Molecular Modeling
15	PDB:6c01A	0.176	0.209	5.607E-6	819	0.041	0.049	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
16	PDB:5vemB	0.209	0.499	6.609E-6	383	0.052	0.133	5vemB.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
17	PDB:7tl7A	0.152	0.267	9.971E-6	531	0.037	0.068	7tl7A.pdb.gz	Serum-Stable and Selective Backbone-N-Methylated Cyclic Peptides That Inhibit Prokaryotic Glycolytic Mutases.
18	PDB:6wevAbA	0.170	0.202	1.925E-5	817	0.046	0.055	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
19	PDB:1ei6A	0.174	0.403	2.567E-5	404	0.037	0.089	1ei6A.pdb.gz	Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
20	PDB:1n2lA	0.209	0.394	3.026E-5	483	0.063	0.128	1n2lA.pdb.gz	Crystal structure of a covalent intermediate of endogenous human arylsulfatase A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5H8A4	0.0	2008	983	1.000	1.000	PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens OX=9606 GN=PIGG PE=1 SV=1
2	Q09782	4.58e-80	278	758	0.174	0.226	GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=las21 PE=3 SV=1
3	F4IJJ8	3.25e-73	263	958	0.145	0.149	F4IJJ8_ARATH GPI ethanolamine phosphate transferase 2 OS=Arabidopsis thaliana OX=3702 GN=At2g22530 PE=1 SV=1
4	Q551Y7	4.46e-73	266	1442	0.133	0.091	Q551Y7_DICDI Transmembrane protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276251 PE=4 SV=1
5	P40367	2.14e-59	221	830	0.141	0.167	GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS21 PE=1 SV=1
6	Q8TEQ8	1.74e-55	211	1089	0.157	0.141	PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens OX=9606 GN=PIGO PE=1 SV=3
7	Q9JJI6	2.35e-53	205	1093	0.155	0.139	PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus OX=10090 GN=Pigo PE=1 SV=2
8	O13663	9.72e-45	177	918	0.121	0.130	GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi13 PE=3 SV=1
9	Q07830	1.97e-40	164	1017	0.136	0.132	GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI13 PE=1 SV=1
10	Q385R1	9.74e-29	126	838	0.107	0.125	Q385R1_TRYB2 GPI ethanolamine phosphate transferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2720 PE=3 SV=1
11	Q8I5R4	8.32e-22	104	1373	0.074	0.053	Q8I5R4_PLAF7 GPI ethanolamine phosphate transferase 3, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1214100 PE=4 SV=2
12	P36051	2.14e-13	77.0	919	0.095	0.101	MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCD4 PE=1 SV=1
13	Q8WZK2	1.22e-11	71.2	935	0.081	0.086	MCD4_SCHPO GPI ethanolamine phosphate transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=its8 PE=1 SV=1
14	G4SNP0	1.17e-10	68.2	912	0.075	0.081	G4SNP0_CAEEL GPI ethanolamine phosphate transferase 1 OS=Caenorhabditis elegans OX=6239 GN=pign-1 PE=1 SV=2
15	Q9R1S3	4.13e-10	66.2	931	0.075	0.079	PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus OX=10090 GN=Pign PE=2 SV=2
16	A0A1W2PS19	1.69e-09	64.3	936	0.073	0.077	A0A1W2PS19_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
17	A0A1W2PQA9	1.94e-09	64.3	970	0.073	0.074	A0A1W2PQA9_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
18	A0A1W2PNR0	2.35e-09	63.9	897	0.075	0.082	A0A1W2PNR0_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
19	A0A1W2PQP4	3.10e-09	63.5	870	0.073	0.083	A0A1W2PQP4_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
20	O95427	3.16e-09	63.5	931	0.073	0.077	PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01676 Metalloenzyme	1.7e+02	13.0	Metalloenzyme superfamily
2	PF01663 Phosphodiest	1.6e-07	42.9	Type I phosphodiesterase / nucleotide pyrophosphatase
3	PF19316 PIGO_PIGG	2.2e-25	101.2	GPI ethanolamine phosphate transferase membrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415203

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281382	0.936	Phosphatidylinositol-glycan biosynthesis class F protein
2	9606.ENSP00000216452	0.892	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
3	9606.ENSP00000225609	0.876	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
4	9606.ENSP00000369820	0.870	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
5	9606.ENSP00000357069	0.866	GPI mannosyltransferase 1
6	9606.ENSP00000164305	0.862	GPI mannosyltransferase 3
7	9606.ENSP00000026218	0.857	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
8	9606.ENSP00000356702	0.828	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
9	9606.ENSP00000482202	0.824	Phosphatidylinositol-glycan biosynthesis class W protein
10	9606.ENSP00000420037	0.801	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
11	9606.ENSP00000363260	0.796	GPI mannosyltransferase 2
12	9606.ENSP00000372335	0.763	Negative elongation factor A
13	9606.ENSP00000312458	0.762	Protein ARV1
14	9606.ENSP00000305653	0.746	Mitochondrial proton/calcium exchanger protein
15	9606.ENSP00000413405	0.730	GPI mannosyltransferase 4
16	9606.ENSP00000305613	0.722	Complexin-1
17	9606.ENSP00000359848	0.708	GPI-anchor transamidase
18	9606.ENSP00000279036	0.687	GPI transamidase component PIG-T
19	9606.ENSP00000381498	0.682	Fibroblast growth factor receptor-like 1
20	9606.ENSP00000300658	0.669	Post-GPI attachment to proteins factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051377	1.000	mannose-ethanolamine phosphotransferase activity
GO:0051267	0.994	CP2 mannose-ethanolamine phosphotransferase activity
GO:0005488	0.888	binding
GO:0005515	0.883	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0019538	0.987	protein metabolic process
GO:1901576	0.982	organic substance biosynthetic process
GO:0044260	0.982	cellular macromolecule metabolic process
GO:0044249	0.978	cellular biosynthetic process
GO:0036211	0.977	protein modification process
GO:0006506	0.966	GPI anchor biosynthetic process
GO:0016254	0.375	preassembly of GPI anchor in ER membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0005829	0.588	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.8.-	1.000	Transferases for other substituted phosphate groups.

[back to server]