StarFunc result for job id Q5H9E4

User Input

>input (307 residues)
MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAM
AVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAA
GLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWP
VLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVLYPLIVLVANMQ
SHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHS
RKELKTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3SY17	0.598	0.616	4.167E-12	297	0.300	0.310	Q3SY17.pdb.gz	S2552_HUMAN Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 OS=Homo sapiens OX=9606 GN=SLC25A52 PE=2 SV=2
2	AFDB:O59674	0.731	0.754	8.735E-11	297	0.218	0.226	O59674.pdb.gz	YB8B_SCHPO Uncharacterized mitochondrial carrier C29A3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A3.11c PE=3 SV=1
3	AFDB:Q9CA93	0.714	0.739	1.079E-10	296	0.195	0.203	Q9CA93.pdb.gz	BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana OX=3702 GN=BAC2 PE=1 SV=1
4	AFDB:Q5HZI9	0.568	0.581	2.309E-10	298	0.316	0.326	Q5HZI9.pdb.gz	S2551_MOUSE Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51 OS=Mus musculus OX=10090 GN=Slc25a51 PE=1 SV=1
5	AFDB:Q4WBL9	0.702	0.670	5.267E-9	324	0.202	0.191	Q4WBL9.pdb.gz	Q4WBL9_ASPFU Mitochondrial ornithine carrier protein AmcA/Ort1, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G02760 PE=3 SV=1
6	AFDB:Q5A1Z2	0.649	0.559	6.237E-9	359	0.186	0.159	Q5A1Z2.pdb.gz	Q5A1Z2_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR02940CA PE=3 SV=1
7	AFDB:Q9M038	0.705	0.701	1.080E-8	309	0.192	0.191	Q9M038.pdb.gz	SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=SFC1 PE=2 SV=1
8	AFDB:Q387M4	0.689	0.683	2.216E-8	310	0.160	0.158	Q387M4.pdb.gz	Q387M4_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0870 PE=3 SV=1
9	AFDB:Q12289	0.648	0.614	2.624E-8	327	0.218	0.205	Q12289.pdb.gz	CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRC1 PE=1 SV=1
10	AFDB:P38087	0.597	0.562	2.737E-8	329	0.241	0.225	P38087.pdb.gz	YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMC2 PE=1 SV=1
11	PDB:6gciA	0.703	0.736	3.298E-7	292	0.186	0.195	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
12	PDB:4c9qB	0.581	0.609	5.966E-5	290	0.169	0.179	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:2c3eA	0.526	0.546	1.481E-3	293	0.202	0.212	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
14	PDB:3puxG	0.186	0.193	4.641E-1	293	0.111	0.116	3puxG.pdb.gz	Snapshots of the maltose transporter during ATP hydrolysis.
15	PDB:7wwbA	0.247	0.233	4.842E-1	333	0.156	0.144	7wwbA.pdb.gz	Rational exploration of fold atlas for human solute carrier proteins.
16	PDB:7nd2A	0.159	0.152	7.388E-1	330	0.127	0.118	7nd2A.pdb.gz
17	PDB:7o3vF	0.170	0.188	8.039E-1	261	0.134	0.157	7o3vF.pdb.gz
18	PDB:7w53R	0.122	0.133	9.126E-1	264	0.137	0.159	7w53R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
19	PDB:7cljA	0.120	0.135	9.520E-1	250	0.098	0.120	7cljA.pdb.gz	Structural basis for unique color tuning mechanism in heliorhodopsin.
20	PDB:7tdeB	0.144	0.107	1.127	470	0.127	0.083	7tdeB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H1U9	1.24e-49	168	297	0.303	0.313	S2551_HUMAN Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51 OS=Homo sapiens OX=9606 GN=SLC25A51 PE=1 SV=1
2	Q5HZI9	4.08e-47	162	298	0.300	0.309	S2551_MOUSE Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51 OS=Mus musculus OX=10090 GN=Slc25a51 PE=1 SV=1
3	Q3SY17	1.20e-45	158	297	0.300	0.310	S2552_HUMAN Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 OS=Homo sapiens OX=9606 GN=SLC25A52 PE=2 SV=2
4	Q12289	2.53e-12	68.6	327	0.225	0.211	CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRC1 PE=1 SV=1
5	O59674	3.09e-11	65.1	297	0.228	0.236	YB8B_SCHPO Uncharacterized mitochondrial carrier C29A3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A3.11c PE=3 SV=1
6	Q8J2Q9	2.53e-10	62.4	306	0.218	0.219	FUM11_GIBM7 Tricarboxylate transporter FUM11 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUM11 PE=3 SV=2
7	Q03028	2.88e-10	62.4	310	0.231	0.229	ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC1 PE=1 SV=1
8	Q9BQT8	9.91e-10	60.8	299	0.238	0.244	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
9	P32331	1.31e-09	60.5	307	0.179	0.179	YMC1_YEAST Mitochondrial glycine transporter YMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMC1 PE=1 SV=2
10	O13844	5.22e-09	58.5	291	0.166	0.175	YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19G12.05 PE=3 SV=1
11	Q8BZ09	5.34e-09	58.5	298	0.195	0.201	ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a21 PE=1 SV=1
12	Q9CA93	3.58e-08	56.2	296	0.215	0.223	BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana OX=3702 GN=BAC2 PE=1 SV=1
13	Q8CFJ7	2.10e-07	53.5	288	0.179	0.191	S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus OX=10090 GN=Slc25a45 PE=1 SV=1
14	P38087	4.05e-07	53.1	329	0.248	0.231	YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMC2 PE=1 SV=1
15	Q5A967	8.39e-07	52.0	284	0.186	0.201	Q5A967_CANAL Carnitine:acyl carnitine antiporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRC1 PE=3 SV=1
16	Q9VA73	9.99e-07	52.4	695	0.238	0.105	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
17	Q99297	1.23e-06	51.6	307	0.192	0.192	ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC2 PE=1 SV=1
18	Q7K0L7	1.98e-06	50.8	332	0.156	0.145	Q7K0L7_DROME LP01207p OS=Drosophila melanogaster OX=7227 GN=Tpc1 PE=1 SV=1
19	Q9FI43	3.45e-05	47.4	487	0.179	0.113	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
20	P53257	5.64e-05	46.6	314	0.163	0.159	TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	9.6e-21	84.8	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217909	0.664	Solute carrier family 25 member 43
2	9606.ENSP00000369407	0.572	Solute carrier family 25 member 35
3	9606.ENSP00000239451	0.533	Mitochondrial ornithine transporter 2
4	9606.ENSP00000320688	0.524	Solute carrier family 25 member 36
5	9606.ENSP00000294454	0.522	Solute carrier family 25 member 34
6	9606.ENSP00000297578	0.510	Mitochondrial folate transporter/carrier

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.998	binding
GO:0008514	0.997	organic anion transmembrane transporter activity
GO:0005515	0.955	protein binding
GO:0046943	0.947	carboxylic acid transmembrane transporter activity
GO:0015605	0.880	organophosphate ester transmembrane transporter activity
GO:0015215	0.854	nucleotide transmembrane transporter activity
GO:0015216	0.743	purine nucleotide transmembrane transporter activity
GO:0000295	0.706	adenine nucleotide transmembrane transporter activity
GO:1901702	0.550	salt transmembrane transporter activity
GO:0015318	0.489	inorganic molecular entity transmembrane transporter activity
GO:0005346	0.328	purine ribonucleotide transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051234	0.998	establishment of localization
GO:0055085	0.990	transmembrane transport
GO:0071702	0.984	organic substance transport
GO:1990542	0.978	mitochondrial transmembrane transport
GO:0071705	0.865	nitrogen compound transport
GO:0044237	0.681	cellular metabolic process
GO:0015711	0.608	organic anion transport
GO:0015931	0.535	nucleobase-containing compound transport
GO:0015748	0.510	organophosphate ester transport
GO:0006862	0.502	nucleotide transport
GO:0015849	0.496	organic acid transport
GO:0046942	0.446	carboxylic acid transport
GO:0071704	0.408	organic substance metabolic process
GO:1903825	0.382	organic acid transmembrane transport
GO:1905039	0.369	carboxylic acid transmembrane transport
GO:0065007	0.321	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005743	0.970	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]