StarFunc result for job id Q5H9F3

User Input

>input (1711 residues)
MISTAPLYSGVHNWTSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKV
ELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPKMDYAGNVAEAEGFLVPLSSPGD
GLKLPASDSAEASNSRADCSWTPLNTQMSKQVDCSPAGVKALDSRQGVGEKNTFILATLG
TGVPVEGTLPLVTTNFSPLPAPICPPAPGSASVPHSVPDAFQVPLSVPAPVPHSGLVPVQ
VATSVPAPSPPLAPVPALAPAPPSVPTLISDSNPLSVSASVLVPVPASAPPSGPVPLSAP
APAPLSVPVSAPPLALIQAPVPPSAPTLVLAPVPTPVLAPMPASTPPAAPAPPSVPMPTP
TPSSGPPSTPTLIPAFAPTPVPAPTPAPIFTPAPTPMPAATPAAIPTSAPIPASFSLSRV
CFPAAQAPAMQKVPLSFQPGTVLTPSQPLVYIPPPSCGQPLSVATLPTTLGVSSTLTLPV
LPSYLQDRCLPGVLASPELRSYPYAFSVARPLTSDSKLVSLEVNRLPCTSPSGSTTTQPA
PDGVPGPLADTSLVTASAKVLPTPQPLLPAPSGSSAPPHPAKMPSGTEQQTEGTSVTFSP
LKSPPQLEREMASPPECSEMPLDLSSKSNRQKLPLPNQRKTPPMPVLTPVHTSSKALLST
VLSRSQRTTQAAGGNVTSCLGSTSSPFVIFPEIVRNGDPSTWVKNSTALISTIPGTYVGV
ANPVPASLLLNKDPNLGLNRDPRHLPKQEPISIIDQGEPKGTGATCGKKGSQAGAEGQPS
TVKRYTPARIAPGLPGCQTKELSLWKPTGPANIYPRCSVNGKPTSTQVLPVGWSPYHQAS
LLSIGISSAGQLTPSQGAPIRPTSVVSEFSGVPSLSSSEAVHGLPEGQPRPGGSFVPEQD
PVTKNKTCRIAAKPYEEQVNPVLLTLSPQTGTLALSVQPSGGDIRMNQGPEESESHLCSD
STPKMEGPQGACGLKLAGDTKPKNQVLATYMSHELVLATPQNLPKMPELPLLPHDSHPKE
LILDVVPSSRRGSSTERPQLGSQVDLGRVKMEKVDGDVVFNLATCFRADGLPVAPQRGQA
EVRAKAGQARVKQESVGVFACKNKWQPDDVTESLPPKKMKCGKEKDSEEQQLQPQAKAVV
RSSHRPKCRKLPSDPQESTKKSPRGASDSGKEHNGVRGKHKHRKPTKPESQSPGKRADSH
EEGSLEKKAKSSFRDFIPVVLSTRTRSQSGSICSSFAGMADSDMGSQEVFPTEEEEEVTP
TPAKRRKVRKTQRDTQYRSHHAQDKSLLSQGRRHLWRAREMPWRTEAARQMWDTNEEEEE
EEEEGLLKRKKRRRQKSRKYQTGEYLTEQEDEQRRKGRADLKARKQKTSSSQSLEHRLRN
RNLLLPNKVQGISDSPNGFLPNNLEEPACLENSEKPSGKRKCKTKHMATVSEEAKDVVLY
CLQKDSEDVNHRDNAGYTALHEACSRGWTDILNILLEHGANVNCSAQDGTRPVHDAVVND
NLETIWLLLSYGADPTLATYSGQTAMKLASSDTMKRFLSDHLSDLQGRAEGDPGVSWDFY
SSSVLEEKDGFACDLLHNPPGSSDQEGDDPMEEDDFMFELSDKPLLPCYNLQVSVSRGPC
NWFLFSDVLKRLKLSSRIFQARFPHFEITTMPKAEFYRQVASSQLLTPAERPGGLDDRSP
PGSSETVELVRYEPDLLRLLGSEVEFQSCNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5H9F3	1.000	1.000	0.000	1711	1.000	1.000	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
2	AFDB:Q8CGN4	0.117	0.115	4.107E-36	1759	0.232	0.226	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
3	AFDB:Q6W2J9	0.128	0.125	4.788E-35	1755	0.233	0.227	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
4	AFDB:F1RCL8	0.098	0.096	2.271E-33	1796	0.231	0.220	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
5	AFDB:Q8IQT4	0.070	0.059	4.066E-17	2133	0.202	0.162	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
6	AFDB:A0A140LI88	0.068	0.063	1.097E-8	1857	0.119	0.109	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
7	PDB:7df7B	0.057	0.738	4.276E-7	119	0.020	0.294	7df7B.pdb.gz
8	PDB:6jd6B	0.067	0.542	2.073E-6	192	0.020	0.182	6jd6B.pdb.gz
9	PDB:1wg0A	0.063	0.354	2.945E-6	243	0.020	0.140	1wg0A.pdb.gz
10	AFDB:Q10124	0.038	0.039	3.381E-6	1647	0.106	0.110	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
11	PDB:2dvwA	0.061	0.428	3.945E-6	229	0.021	0.157	2dvwA.pdb.gz
12	PDB:3ehqA	0.062	0.555	4.182E-6	182	0.017	0.159	3ehqA.pdb.gz
13	PDB:8cs9A	0.063	0.132	5.602E-6	796	0.020	0.044	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:5vkqA	0.062	0.070	7.505E-6	1499	0.020	0.023	5vkqA.pdb.gz
15	PDB:6mwqA	0.063	0.214	1.913E-5	493	0.022	0.077	6mwqA.pdb.gz
16	PDB:1bd8A	0.059	0.570	2.150E-5	156	0.019	0.205	1bd8A.pdb.gz
17	PDB:4oauC	0.064	0.154	2.880E-5	692	0.020	0.049	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
18	AFDB:X2JEM2	0.040	0.035	5.475E-4	2326	0.113	0.083	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
19	AFDB:F1QM29	0.031	0.035	8.245E-4	1413	0.096	0.117	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
20	AFDB:Q9Y3S1	0.036	0.030	1.982E-3	2297	0.182	0.136	Q9Y3S1.pdb.gz	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C4B2	0.0	1340	741	0.388	0.896	H7C4B2_HUMAN BCL6 corepressor like 1 (Fragment) OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=1
2	Q5H9F3	0.0	3355	1785	0.987	0.946	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
3	Q8CGN4	2.20e-90	328	1759	0.091	0.089	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
4	H7C231	6.99e-90	327	1737	0.092	0.091	H7C231_HUMAN BCL6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=3
5	Q6W2J9	7.26e-90	327	1755	0.092	0.090	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
6	Q6W2J8	1.37e-89	326	1777	0.091	0.088	Q6W2J8_DANRE BCL-6 corepressor OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
7	F1RCL8	1.49e-89	326	1796	0.091	0.087	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
8	H7C2V9	3.02e-86	315	1690	0.086	0.087	H7C2V9_HUMAN BCL6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=2
9	H7BZ37	2.11e-65	248	1659	0.068	0.071	H7BZ37_HUMAN BCL6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=2
10	Q8IQT4	1.78e-32	141	2133	0.041	0.033	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
11	Q8MT12	4.87e-32	134	453	0.038	0.143	Q8MT12_DROME SD21394p OS=Drosophila melanogaster OX=7227 GN=CG14073 PE=2 SV=1
12	Q59GC3	6.30e-18	90.9	439	0.027	0.105	Q59GC3_HUMAN Ankyrin repeat domain 11 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
13	E9Q4F7	3.02e-17	91.3	2643	0.027	0.018	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
14	Q6UB99	3.11e-17	91.3	2663	0.027	0.017	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
15	A0A140LI88	3.13e-14	81.3	1857	0.023	0.022	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
16	A0A2R8Y438	3.96e-14	80.5	944	0.024	0.043	A0A2R8Y438_HUMAN Ankyrin repeat domain containing 11 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
17	Q9BR61	1.91e-13	75.1	282	0.024	0.145	ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ACBD6 PE=1 SV=1
18	P40480	1.45e-12	75.5	1083	0.023	0.036	HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOS4 PE=1 SV=1
19	Q3UES3	2.58e-12	74.7	1166	0.022	0.033	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
20	Q9H2K2	4.15e-12	73.9	1166	0.022	0.033	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.00082	30.9	Ankyrin repeat
2	PF12796 Ank_2	1.2e-07	43.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.0093	27.3	Ankyrin repeat
4	PF13637 Ank_4	6.1e-05	34.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-05	36.3	Ankyrin repeats (many copies)
6	PF16553 PUFD	1.7e-46	168.3	BCORL-PCGF1-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437775

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233630	0.993	Polycomb group RING finger protein 1
2	9606.ENSP00000366271	0.969	Lysine-specific demethylase 2B
3	9606.ENSP00000290921	0.905	C-terminal-binding protein 1
4	9606.ENSP00000354724	0.896	Polycomb group RING finger protein 3
5	9606.ENSP00000419494	0.856	RING1 and YY1-binding protein
6	9606.ENSP00000231487	0.831	S-phase kinase-associated protein 1
7	9606.ENSP00000384371	0.823	B-cell lymphoma 6 protein
8	9606.ENSP00000328004	0.792	YY1 associated factor 2, isoform CRA_d
9	9606.ENSP00000356480	0.782	E3 ubiquitin-protein ligase RING2
10	9606.ENSP00000264606	0.759	Histone deacetylase 4
11	9606.ENSP00000080059	0.737	Histone deacetylase 7
12	9606.ENSP00000276202	0.698	Dedicator of cytokinesis protein 11
13	9606.ENSP00000303015	0.691	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
14	9606.ENSP00000364839	0.688	Putative Polycomb group protein ASXL1
15	9606.ENSP00000329097	0.677	PHD finger protein 6
16	9606.ENSP00000377699	0.676	Adhesion G-protein coupled receptor G4
17	9606.ENSP00000377944	0.667	U3 small nucleolar RNA-associated protein 14 homolog A
18	9606.ENSP00000482063	0.662	Polycomb group RING finger protein 2
19	9606.ENSP00000282892	0.658	Mediator of RNA polymerase II transcription subunit 21
20	9606.ENSP00000408617	0.644	Histone deacetylase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0051171	0.939	regulation of nitrogen compound metabolic process
GO:0080090	0.840	regulation of primary metabolic process
GO:0048519	0.834	negative regulation of biological process
GO:0031323	0.814	regulation of cellular metabolic process
GO:0010468	0.807	regulation of gene expression
GO:0009889	0.799	regulation of biosynthetic process
GO:0010556	0.788	regulation of macromolecule biosynthetic process
GO:0031326	0.775	regulation of cellular biosynthetic process
GO:0019219	0.772	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.757	negative regulation of cellular process
GO:0051252	0.757	regulation of RNA metabolic process
GO:0006355	0.753	regulation of DNA-templated transcription
GO:0009987	0.729	cellular process
GO:0009892	0.540	negative regulation of metabolic process
GO:0010605	0.524	negative regulation of macromolecule metabolic process
GO:0071704	0.477	organic substance metabolic process
GO:0051172	0.463	negative regulation of nitrogen compound metabolic process
GO:0031324	0.461	negative regulation of cellular metabolic process
GO:0048518	0.428	positive regulation of biological process
GO:0043170	0.399	macromolecule metabolic process
GO:0006357	0.354	regulation of transcription by RNA polymerase II
GO:0048522	0.344	positive regulation of cellular process
GO:0045934	0.339	negative regulation of nucleobase-containing compound metabolic process
GO:0032501	0.336	multicellular organismal process
GO:0031327	0.307	negative regulation of cellular biosynthetic process
GO:0051253	0.307	negative regulation of RNA metabolic process
GO:0010558	0.305	negative regulation of macromolecule biosynthetic process
GO:0045892	0.304	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005886	0.997	plasma membrane
GO:0005737	0.669	cytoplasm
GO:0032991	0.437	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]