StarFunc result for job id Q5H9I0

User Input

>input (405 residues)
MAKYVSLTEANEELKVLMDENQTSRPVAVHTSTVNPLGKQLLPKTFGQSSVNIDQQVVIG
MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE
TVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISRE
KKKIKWIGLTTNSAQNCQNLRVERQKRLERIKQKQSELQQLILQQIAFKNLVLRNQYVEE
QVSQRPLPNSVIHVPFIIISSSKKTVINCSISDDKSEYLFKFNSSFEIHDDTEVLMWMGM
TFGLESGSCSAEDLKMARNLVPKALEPYVTEMAQGTFGGVFTTAGSRSNGTWLSASDLTN
IAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5H9I0	1.000	1.000	1.553E-65	405	1.000	1.000	Q5H9I0.pdb.gz	TFDP3_HUMAN Transcription factor Dp family member 3 OS=Homo sapiens OX=9606 GN=TFDP3 PE=1 SV=1
2	AFDB:A0A024RDY4	0.499	0.494	1.359E-48	410	0.751	0.741	A0A024RDY4.pdb.gz
3	AFDB:Q22703	0.403	0.282	2.418E-22	598	0.289	0.196	Q22703.pdb.gz	TFDP1_CAEEL Transcription factor dpl-1 OS=Caenorhabditis elegans OX=6239 GN=dpl-1 PE=1 SV=2
4	AFDB:Q9FNY2	0.406	0.424	5.906E-18	385	0.259	0.273	Q9FNY2.pdb.gz	DPB_ARATH Transcription factor-like protein DPB OS=Arabidopsis thaliana OX=3702 GN=DPB PE=1 SV=1
5	AFDB:Q9FNY3	0.364	0.480	1.963E-16	292	0.173	0.240	Q9FNY3.pdb.gz	DPA_ARATH Transcription factor-like protein DPA OS=Arabidopsis thaliana OX=3702 GN=DPA PE=1 SV=1
6	AFDB:Q9FNY0	0.149	0.127	1.016E-6	485	0.138	0.115	Q9FNY0.pdb.gz	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
7	AFDB:Q01094	0.186	0.174	1.931E-6	437	0.146	0.135	Q01094.pdb.gz	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
8	AFDB:Q9FV70	0.180	0.183	6.210E-6	396	0.126	0.129	Q9FV70.pdb.gz	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
9	AFDB:Q27368	0.140	0.074	8.816E-6	805	0.190	0.096	Q27368.pdb.gz	E2F1_DROME Transcription factor E2f1 OS=Drosophila melanogaster OX=7227 GN=E2f1 PE=1 SV=2
10	AFDB:O94988	0.104	0.051	2.340E-2	1023	0.104	0.041	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
11	PDB:3euhC	0.144	0.262	3.445E-2	206	0.037	0.073	3euhC.pdb.gz
12	PDB:1ldjA	0.142	0.081	4.613E-2	725	0.020	0.011	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
13	PDB:8d0bB	0.148	0.164	6.549E-2	362	0.032	0.036	8d0bB.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
14	PDB:6w6wC	0.152	0.181	1.320E-1	323	0.032	0.040	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
15	PDB:4ad9A	0.144	0.198	2.106E-1	288	0.022	0.031	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
16	PDB:1xsdA	0.139	0.407	3.562E-1	125	0.030	0.096	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
17	PDB:4a0kA	0.134	0.077	3.562E-1	719	0.020	0.011	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
18	PDB:6qpqD	0.131	0.486	3.562E-1	82	0.022	0.110	6qpqD.pdb.gz
19	PDB:6v9iC	0.144	0.082	3.562E-1	730	0.022	0.012	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
20	PDB:7z1mO	0.099	0.072	3.562E-1	570	0.072	0.051	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08639	0.0	546	410	0.696	0.688	TFDP1_MOUSE Transcription factor Dp-1 OS=Mus musculus OX=10090 GN=Tfdp1 PE=1 SV=1
2	Q14186	0.0	579	410	0.733	0.724	TFDP1_HUMAN Transcription factor Dp-1 OS=Homo sapiens OX=9606 GN=TFDP1 PE=1 SV=1
3	Q5H9I0	0.0	845	405	1.000	1.000	TFDP3_HUMAN Transcription factor Dp family member 3 OS=Homo sapiens OX=9606 GN=TFDP3 PE=1 SV=1
4	Q5JSB5	1.51e-115	338	235	0.437	0.753	Q5JSB5_HUMAN Transcription factor Dp-1 (Fragment) OS=Homo sapiens OX=9606 GN=TFDP1 PE=1 SV=8
5	A0A0G2JXE8	3.31e-114	343	447	0.509	0.461	A0A0G2JXE8_RAT Transcription factor OS=Rattus norvegicus OX=10116 GN=Tfdp2 PE=3 SV=2
6	Q14188	1.77e-112	338	446	0.467	0.424	TFDP2_HUMAN Transcription factor Dp-2 OS=Homo sapiens OX=9606 GN=TFDP2 PE=1 SV=2
7	F7EWM8	4.82e-110	331	429	0.491	0.464	F7EWM8_RAT Transcription factor OS=Rattus norvegicus OX=10116 GN=Tfdp2 PE=3 SV=1
8	A0A8I6A8L4	2.46e-105	318	386	0.457	0.479	A0A8I6A8L4_RAT Transcription factor OS=Rattus norvegicus OX=10116 GN=Tfdp2 PE=3 SV=1
9	A0A8I6A268	3.23e-105	318	387	0.457	0.478	A0A8I6A268_RAT Transcription factor OS=Rattus norvegicus OX=10116 GN=Tfdp2 PE=3 SV=1
10	B5DF82	2.40e-104	315	385	0.459	0.483	B5DF82_RAT Transcription factor OS=Rattus norvegicus OX=10116 GN=Tfdp2 PE=2 SV=1
11	A0A8I5ZNQ2	2.98e-103	312	382	0.457	0.484	A0A8I5ZNQ2_RAT Transcription factor OS=Rattus norvegicus OX=10116 GN=Tfdp2 PE=3 SV=1
12	Q64163	1.61e-100	308	446	0.442	0.401	TFDP2_MOUSE Transcription factor Dp-2 OS=Mus musculus OX=10090 GN=Tfdp2 PE=1 SV=2
13	Q24318	1.51e-66	220	445	0.284	0.258	TFDP_DROME Transcription factor Dp OS=Drosophila melanogaster OX=7227 GN=Dp PE=1 SV=2
14	Q5JSB6	3.39e-63	202	158	0.274	0.703	Q5JSB6_HUMAN Transcription factor Dp-1 (Fragment) OS=Homo sapiens OX=9606 GN=TFDP1 PE=1 SV=8
15	Q22703	8.11e-53	187	598	0.235	0.159	TFDP1_CAEEL Transcription factor dpl-1 OS=Caenorhabditis elegans OX=6239 GN=dpl-1 PE=1 SV=2
16	Q9FNY2	1.76e-41	152	385	0.210	0.221	DPB_ARATH Transcription factor-like protein DPB OS=Arabidopsis thaliana OX=3702 GN=DPB PE=1 SV=1
17	Q9FNY3	8.96e-29	115	292	0.160	0.223	DPA_ARATH Transcription factor-like protein DPA OS=Arabidopsis thaliana OX=3702 GN=DPA PE=1 SV=1
18	Q9FV71	0.039	38.5	469	0.079	0.068	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
19	Q61502	0.091	37.0	335	0.086	0.104	E2F5_MOUSE Transcription factor E2F5 OS=Mus musculus OX=10090 GN=E2f5 PE=1 SV=2
20	Q16254	0.093	37.4	413	0.052	0.051	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08781 DP	8.3e-49	176.5	Transcription factor DP
2	PF02319 E2F_TDP	2.7e-13	60.9	E2F/DP family winged-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368686	0.946	Transcription factor E2F4
2	9606.ENSP00000398124	0.924	Transcription factor E2F5
3	9606.ENSP00000339208	0.915	Dipeptidyl peptidase 8
4	9606.ENSP00000262904	0.872	Transcription factor E2F3
5	9606.ENSP00000257572	0.833	Activator of apoptosis harakiri
6	9606.ENSP00000362768	0.818	Retinoblastoma-like protein 1
7	9606.ENSP00000257430	0.803	Adenomatous polyposis coli protein
8	9606.ENSP00000370936	0.798	Transcription factor E2F6
9	9606.ENSP00000323246	0.788	Transcription factor E2F7
10	9606.ENSP00000481103	0.785	Transcription factor E2F8
11	9606.ENSP00000262960	0.770	Dipeptidyl peptidase 9
12	9606.ENSP00000355249	0.760	Transcription factor E2F2
13	9606.ENSP00000262133	0.707	Retinoblastoma-like protein 2
14	9606.ENSP00000267163	0.704	Retinoblastoma-associated protein
15	9606.ENSP00000345571	0.700	Transcription factor E2F1
16	9606.ENSP00000307940	0.619	Elongation factor 2
17	9606.ENSP00000469441	0.566	Cancer/testis antigen 1A
18	9606.ENSP00000332602	0.565	Cancer/testis antigen 1B
19	9606.ENSP00000448165	0.523	Apoptotic protease-activating factor 1
20	9606.ENSP00000473093	0.518	Melanoma-associated antigen 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140416	1.000	transcription regulator inhibitor activity
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0061629	0.995	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003677	0.944	DNA binding
GO:0043565	0.903	sequence-specific DNA binding
GO:0003690	0.731	double-stranded DNA binding
GO:0001067	0.706	transcription regulatory region nucleic acid binding
GO:0000976	0.696	transcription cis-regulatory region binding
GO:0000981	0.537	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019219	0.996	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0009987	0.979	cellular process
GO:0048519	0.966	negative regulation of biological process
GO:0048523	0.964	negative regulation of cellular process
GO:0010468	0.964	regulation of gene expression
GO:0010556	0.951	regulation of macromolecule biosynthetic process
GO:0031326	0.951	regulation of cellular biosynthetic process
GO:0051252	0.951	regulation of RNA metabolic process
GO:1903506	0.942	regulation of nucleic acid-templated transcription
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0051726	0.920	regulation of cell cycle
GO:0045786	0.825	negative regulation of cell cycle
GO:0010564	0.817	regulation of cell cycle process
GO:0007346	0.816	regulation of mitotic cell cycle
GO:0050896	0.799	response to stimulus
GO:1902806	0.776	regulation of cell cycle G1/S phase transition
GO:1901990	0.765	regulation of mitotic cell cycle phase transition
GO:0010948	0.752	negative regulation of cell cycle process
GO:0065009	0.748	regulation of molecular function
GO:0051716	0.661	cellular response to stimulus
GO:0048518	0.575	positive regulation of biological process
GO:1901988	0.529	negative regulation of cell cycle phase transition
GO:0048522	0.500	positive regulation of cellular process
GO:0006950	0.467	response to stress
GO:0045930	0.416	negative regulation of mitotic cell cycle
GO:2000045	0.368	regulation of G1/S transition of mitotic cell cycle
GO:0009893	0.337	positive regulation of metabolic process
GO:0010604	0.331	positive regulation of macromolecule metabolic process
GO:0051173	0.325	positive regulation of nitrogen compound metabolic process
GO:0044092	0.312	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.996	nucleus
GO:0005654	0.990	nucleoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.980	protein-containing complex
GO:0005667	0.780	transcription regulator complex
GO:0140513	0.351	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]