StarFunc result for job id Q5H9L4

User Input

>input (462 residues)
MECPEGQLPISSENDSTPTVSTSEVTSQQEPQILVDRGSETTYESSADIAGDEGTQIPAD
EDTQTDADSSAQAAAQAPENFQEGKDMSESQDEVPDEVENQFILRLPLEHACTVRNLARS
QSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQM
LVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKK
VPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGF
LISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDDDEDEDDEDEDEDEDEDEDEDKEEEEE
DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIM
KVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5H9L4	1.000	1.000	1.735E-72	462	1.000	1.000	Q5H9L4.pdb.gz	TAF7L_HUMAN Transcription initiation factor TFIID subunit 7-like OS=Homo sapiens OX=9606 GN=TAF7L PE=1 SV=1
2	AFDB:Q15545	0.319	0.416	2.974E-35	349	0.459	0.607	Q15545.pdb.gz	TAF7_HUMAN Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1
3	PDB:7edxG	0.297	0.905	6.258E-18	145	0.225	0.717	7edxG.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	AFDB:O13701	0.343	0.395	1.268E-16	393	0.234	0.275	O13701.pdb.gz	TAF7_SCHPO Transcription initiation factor TFIID subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf7 PE=1 SV=1
5	AFDB:Q94546	0.133	0.087	2.121E-5	725	0.113	0.072	Q94546.pdb.gz	ATU_DROME Another transcription unit protein OS=Drosophila melanogaster OX=7227 GN=Atu PE=1 SV=2
6	PDB:5msmB	0.125	0.380	5.771E-3	132	0.037	0.129	5msmB.pdb.gz	Structural studies of RFC(C)(tf18) reveal a novel chromatin recruitment role for Dcc1.
7	PDB:7okxM	0.150	0.427	8.698E-3	139	0.032	0.108	7okxM.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
8	AFDB:P53882	0.066	0.052	8.871E-3	636	0.093	0.068	P53882.pdb.gz	TDA7_YEAST Topoisomerase I damage affected protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA7 PE=1 SV=2
9	AFDB:Q86SQ0	0.130	0.048	9.974E-3	1253	0.154	0.057	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
10	PDB:7d58N	0.131	0.352	1.037E-2	136	0.050	0.169	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
11	PDB:7edxT	0.152	0.515	1.100E-2	113	0.026	0.106	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	PDB:6o9lT	0.151	0.273	1.311E-2	237	0.043	0.084	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
13	PDB:5svag	0.146	0.358	1.863E-2	172	0.028	0.076	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
14	PDB:3pufI	0.106	0.275	2.808E-2	140	0.026	0.086	3pufI.pdb.gz
15	PDB:6s1cF	0.114	0.168	2.978E-2	299	0.032	0.050	6s1cF.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
16	PDB:3p5jC	0.138	0.444	3.992E-2	116	0.017	0.069	3p5jC.pdb.gz
17	AFDB:Q08562	0.138	0.047	5.786E-2	1619	0.147	0.042	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
18	AFDB:Q54TL0	0.094	0.045	2.362E-1	1255	0.126	0.046	Q54TL0.pdb.gz	KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum OX=44689 GN=kif7 PE=2 SV=1
19	AFDB:A0A0B4KGR6	0.085	0.041	3.357E-1	1113	0.141	0.058	A0A0B4KGR6.pdb.gz	A0A0B4KGR6_DROME Myosin heavy chain-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=4 SV=1
20	AFDB:Q86A08	0.089	0.054	4.243E-1	799	0.123	0.071	Q86A08.pdb.gz	Q86A08_DICDI Centrosomal protein 91 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275495 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5H9L4	0.0	941	462	1.000	1.000	TAF7L_HUMAN Transcription initiation factor TFIID subunit 7-like OS=Homo sapiens OX=9606 GN=TAF7L PE=1 SV=1
2	Q6R1L1	1.14e-123	365	341	0.457	0.619	TAF7_CRIGR Transcription initiation factor TFIID subunit 7 OS=Cricetulus griseus OX=10029 GN=TAF7 PE=1 SV=1
3	Q15545	3.98e-121	359	349	0.452	0.599	TAF7_HUMAN Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1
4	Q9R1C0	1.05e-119	355	341	0.446	0.604	TAF7_MOUSE Transcription initiation factor TFIID subunit 7 OS=Mus musculus OX=10090 GN=Taf7 PE=1 SV=1
5	Q9D3R9	2.68e-119	358	471	0.509	0.499	TAF7L_MOUSE Transcription initiation factor TFIID subunit 7-like OS=Mus musculus OX=10090 GN=Taf7l PE=1 SV=2
6	O13701	4.18e-19	91.3	393	0.175	0.206	TAF7_SCHPO Transcription initiation factor TFIID subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf7 PE=1 SV=1
7	Q05021	3.51e-12	70.9	590	0.106	0.083	TAF7_YEAST Transcription initiation factor TFIID subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04658 TAFII55_N	4.5e-54	194.1	TAFII55 protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355051	0.993	Transcription initiation factor TFIID subunit 13
2	9606.ENSP00000375942	0.983	TATA-box-binding protein
3	9606.ENSP00000362068	0.981	Transcription initiation factor TFIID subunit 8
4	9606.ENSP00000252996	0.978	Transcription initiation factor TFIID subunit 4
5	9606.ENSP00000406549	0.974	Transcription initiation factor TFIID subunit 1
6	9606.ENSP00000299424	0.973	Transcription initiation factor TFIID subunit 10
7	9606.ENSP00000340271	0.972	Transcription initiation factor TFIID subunit 3
8	9606.ENSP00000399982	0.971	Transcription initiation factor TFIID subunit 6
9	9606.ENSP00000367406	0.963	Transcription initiation factor TFIID subunit 2
10	9606.ENSP00000263974	0.953	Transcription initiation factor TFIID subunit 12
11	9606.ENSP00000269142	0.952	Transcription initiation factor TFIID subunit 4B
12	9606.ENSP00000339917	0.951	Transcription initiation factor TFIID subunit 9B
13	9606.ENSP00000354633	0.951	Transcription initiation factor TFIID subunit 11
14	9606.ENSP00000358854	0.946	Transcription initiation factor TFIID subunit 5
15	9606.ENSP00000418379	0.911	Transcription initiation factor TFIID subunit 1-like
16	9606.ENSP00000247219	0.903	TATA box-binding protein-like protein 2
17	9606.ENSP00000312709	0.903	Transcription initiation factor TFIID subunit 7
18	9606.ENSP00000269305	0.901	Cellular tumor antigen p53
19	9606.ENSP00000287820	0.901	Peroxisome proliferator-activated receptor gamma
20	9606.ENSP00000370193	0.845	Transcription initiation factor TFIID subunit 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0008152	0.945	metabolic process
GO:0071704	0.928	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0006807	0.915	nitrogen compound metabolic process
GO:0044237	0.908	cellular metabolic process
GO:0050789	0.903	regulation of biological process
GO:0043170	0.899	macromolecule metabolic process
GO:0034641	0.878	cellular nitrogen compound metabolic process
GO:0006725	0.868	cellular aromatic compound metabolic process
GO:1901360	0.864	organic cyclic compound metabolic process
GO:0046483	0.864	heterocycle metabolic process
GO:0050794	0.845	regulation of cellular process
GO:0010467	0.839	gene expression
GO:0006139	0.825	nucleobase-containing compound metabolic process
GO:0090304	0.824	nucleic acid metabolic process
GO:0018130	0.819	heterocycle biosynthetic process
GO:0097659	0.814	nucleic acid-templated transcription
GO:0032502	0.800	developmental process
GO:0032501	0.800	multicellular organismal process
GO:0006351	0.798	DNA-templated transcription
GO:0031323	0.747	regulation of cellular metabolic process
GO:0006366	0.689	transcription by RNA polymerase II
GO:0022414	0.680	reproductive process
GO:0048609	0.662	multicellular organismal reproductive process
GO:0048232	0.625	male gamete generation
GO:0060255	0.605	regulation of macromolecule metabolic process
GO:0051171	0.605	regulation of nitrogen compound metabolic process
GO:0001539	0.594	cilium or flagellum-dependent cell motility
GO:0007283	0.587	spermatogenesis
GO:0080090	0.576	regulation of primary metabolic process
GO:0010468	0.539	regulation of gene expression
GO:0010556	0.530	regulation of macromolecule biosynthetic process
GO:0031326	0.530	regulation of cellular biosynthetic process
GO:0051252	0.529	regulation of RNA metabolic process
GO:0006355	0.513	regulation of DNA-templated transcription
GO:1901564	0.464	organonitrogen compound metabolic process
GO:0006357	0.457	regulation of transcription by RNA polymerase II
GO:0019538	0.444	protein metabolic process
GO:0071840	0.400	cellular component organization or biogenesis
GO:0016043	0.358	cellular component organization
GO:0036211	0.316	protein modification process
GO:0048522	0.305	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.996	protein-containing complex
GO:0031981	0.995	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005737	0.990	cytoplasm
GO:0140513	0.976	nuclear protein-containing complex
GO:1990234	0.965	transferase complex
GO:0140535	0.961	intracellular protein-containing complex
GO:0005667	0.939	transcription regulator complex
GO:0016591	0.932	RNA polymerase II, holoenzyme
GO:0090575	0.920	RNA polymerase II transcription regulator complex
GO:0043073	0.812	germ cell nucleus
GO:0005669	0.810	transcription factor TFIID complex
GO:0001673	0.748	male germ cell nucleus
GO:0043232	0.735	intracellular non-membrane-bounded organelle
GO:0000123	0.505	histone acetyltransferase complex
GO:0071339	0.404	MLL1 complex
GO:0033276	0.380	transcription factor TFTC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]