StarFunc result for job id Q5H9U9

User Input

>input (1706 residues)
MGSKDHAVFFREMTQLILNEMPKAGYSSILNDFVESNFFVIDGDSLLVTCLGVKSFKWGQ
NLHFFYLVECYLVDLLSNGGQFTIVFFKDAEYAYFDFPELLSLRTALILHLQHNTNIDVQ
TEFSGCLSQDWKLFLEQHYPYFLIVSEEGLSDLQTYLFNFLIIHSWGMKVNVVLSSGHES
DTLRFYAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKWNDMME
EAYQTLFLLQHLWSEGSDIQRVLCVTSCSLSLRMYHRVLVHSNCLSLQEVEDFCRLRCLC
VAFQLHLPLSQRACSRVITCSWIRNSDSFLKMNKWCEYFILSNLNVFGCWNLNLNHVSDL
YDEQLLKNIAFYYEFESTQEPHLNLGDSIRRDYEDLWNVVSHLVKEFNVGKSFPLRTTRR
HFLRQEKSVIQEISLEKMPSVGFIPMTSAVIDEFVGDMMKDLPILKSDDPVVPSLFKQKT
SDELLHWHAQRLLSDDYDRIKCHVDEQSRDPHVLDFLKKIQDYQQFYGKSLESISTKVIV
TQTTRPKEDSSGASGEILQNTKPHQITKKSKKKSFLKEDQNKAQQNDDLLFSIEEEMKNN
LHSGIRKLEDYLTSCASNSVKFGVEMLGLIACFKAWKKHCRGEGKISKDLSIAVQMMKRI
HSLLERYPEILEAEHHQYIAKCLKYLGFNDLANSLDPTLIGDDKNKKKYSIDIGPARFQL
QYMGHYLIRDERKDRDPRVQDFIPNAWQQELLDVVDKNESAVIVAPTSSGKTYASYYCME
KVLRESDVGVVVYVAPAKSLVGQVAATVENRFTKTLPAGRTLCGAFTRDYCHNVLNCQVL
ITVPECFEILLLAPHRQKWVERIRYVIFDEVHYLGREVGAKFWELLLVIIRCPFLVLSAT
INNPNLLTKWLQSVKQYWKQADKIMEEKCISEKQADKCLNFLQDHSYKNQSYEVRLVLYG
ERYNDLEKHICSVKHDDVYFDHFHPCAALTTDIIEKYGFPPDLTLTPQESIQLYDTMAQV
WETWPRAQELCPEEFILFKNKIVIKKLDARKYEENLKAELTNWIKNGQVKKVKRVLKNLS
PDSLSSSKDMVKMFPLLVEKLRQMDKLPAIFFLFKNDDVGKRAGSVCTFLEKTETKSHPH
TECHSYVFAIDEVLEKVRKTQKRITKKNPKKAEKLERKKVYRAEYINFLENLKILEISED
CTYADVKALHTEITRNKDSTLERVLPRVRFTRHGKELKALAQRGIGYHHSSMYFKEKEFV
EILFVKGLIRVVTATETLALGIHMPCKSVVFAQDSVYLDALNYRQMSGRAGRRGQDLLGN
VYFFDIPLPKIKRLLASSVPELRGQFPLSITLVLRLMLLASKGDDPEDAKAKVLSVLKHS
LLSFKRRRAMETLKLYFLFSLQLLIKEDYLNKKGNPKKFAGLASYLHGHEPSNLVFVNFL
KRGLFHNLCKPAWKGSQQFSQDVMEKLVLVLANLFGRKYIPAKFQNANLSFSQSKVILAE
LPEDFKAALYEYNLAVMKDFASFLLIASKSVNMKKEHQLPLSRIKFTGKECEDSQLVSHL
MSCKKGRVAISPFVCLSGNTDNDLLRPETINQVILRTVGVSGTQAPLLWPWKLDNRGRRM
PLNAYVLNFYKHNCLTRLDQKNGMRMGQLLKCLKDFAFNIQAISDSLSELCENKRDNVVL
AFKQLSQTFYEKLQEMQIQMSQNHLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PZQ1	0.939	0.936	0.000	1711	0.620	0.618	E9PZQ1.pdb.gz	E9PZQ1_MOUSE DExD/H box helicase 60 OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
2	AFDB:Q8IY21	0.932	0.929	0.000	1712	0.659	0.657	Q8IY21.pdb.gz	DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens OX=9606 GN=DDX60 PE=1 SV=3
3	AFDB:Q9P7T8	0.768	0.763	1.441E-78	1717	0.244	0.242	Q9P7T8.pdb.gz	YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC694.02 PE=3 SV=1
4	AFDB:Q582X2	0.393	0.316	1.496E-56	2170	0.242	0.190	Q582X2.pdb.gz	Q582X2_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.220 PE=4 SV=1
5	PDB:6d6qM	0.282	0.622	2.431E-19	709	0.093	0.224	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
6	PDB:6ro1A	0.252	0.439	5.290E-19	919	0.103	0.192	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
7	AFDB:F4JAA5	0.258	0.320	7.389E-19	1347	0.107	0.135	F4JAA5.pdb.gz	SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana OX=3702 GN=SKI2 PE=1 SV=1
8	AFDB:O13799	0.249	0.395	8.056E-19	1030	0.103	0.171	O13799.pdb.gz	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
9	AFDB:Q38AL9	0.260	0.440	1.044E-18	950	0.098	0.177	Q38AL9.pdb.gz	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
10	AFDB:P9WMR1	0.258	0.458	1.540E-18	906	0.087	0.164	P9WMR1.pdb.gz	HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=helY PE=1 SV=1
11	AFDB:Q9XIF2	0.259	0.424	1.540E-18	988	0.100	0.172	Q9XIF2.pdb.gz	MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana OX=3702 GN=MTR4 PE=2 SV=1
12	PDB:2xgjB	0.246	0.502	1.626E-18	777	0.092	0.202	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
13	AFDB:O59801	0.264	0.360	5.624E-18	1213	0.094	0.133	O59801.pdb.gz	SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.03c PE=3 SV=1
14	PDB:6iegA	0.266	0.483	7.057E-18	872	0.096	0.188	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
15	PDB:7qdyA	0.250	0.354	2.169E-17	1169	0.092	0.134	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
16	PDB:4xgtA	0.254	0.428	8.891E-16	961	0.083	0.147	4xgtA.pdb.gz
17	PDB:5mc6h	0.209	0.310	5.222E-15	1121	0.076	0.116	5mc6h.pdb.gz	The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.
18	PDB:7d4iM4	0.217	0.363	2.079E-14	978	0.075	0.131	7d4iM4.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
19	PDB:7z4yB	0.238	0.417	2.937E-14	930	0.104	0.191	7z4yB.pdb.gz
20	PDB:6qw65B	0.228	0.197	3.974E-14	2001	0.096	0.082	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3G9HN97	0.0	2286	1712	0.662	0.660	A0A3G9HN97_HUMAN ATP-dependent RNA helicase DDX60 OS=Homo sapiens OX=9606 GN=DDX60 PE=2 SV=1
2	D3Z3B3	0.0	642	573	0.188	0.560	D3Z3B3_MOUSE DExD/H box helicase 60 (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
3	E9PZQ1	0.0	2122	1711	0.624	0.622	E9PZQ1_MOUSE DExD/H box helicase 60 OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
4	G3X9F7	0.0	2115	1710	0.623	0.621	G3X9F7_MOUSE DExD/H box helicase 60 OS=Mus musculus OX=10090 GN=Ddx60 PE=1 SV=1
5	Q811K8	0.0	642	586	0.190	0.553	Q811K8_MOUSE Ddx60 protein (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=2 SV=1
6	Q8CB98	0.0	643	578	0.190	0.561	Q8CB98_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=2 SV=1
7	Q8IY21	0.0	2286	1712	0.662	0.660	DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens OX=9606 GN=DDX60 PE=1 SV=3
8	Q91VI2	4.05e-178	542	391	0.154	0.673	Q91VI2_MOUSE Ddx60 protein OS=Mus musculus OX=10090 GN=Ddx60 PE=2 SV=1
9	Q9P7T8	6.37e-117	410	1717	0.189	0.188	YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC694.02 PE=3 SV=1
10	Q582X2	4.08e-57	221	2170	0.100	0.078	Q582X2_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.220 PE=4 SV=1
11	O13799	3.25e-19	97.1	1030	0.045	0.075	YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.02 PE=1 SV=1
12	D3YZ76	3.70e-19	85.1	69	0.024	0.594	D3YZ76_MOUSE DExD/H box helicase 60 (Fragment) OS=Mus musculus OX=10090 GN=Ddx60 PE=4 SV=1
13	Q588V7	6.41e-18	93.2	2154	0.031	0.025	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1
14	Q15477	1.46e-17	92.0	1246	0.033	0.046	SKI2_HUMAN Superkiller complex protein 2 OS=Homo sapiens OX=9606 GN=SKIC2 PE=1 SV=3
15	Q38AL9	1.46e-17	91.7	950	0.040	0.073	Q38AL9_TRYB2 ATP-dependent DEAD/H RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3220 PE=4 SV=1
16	O59801	7.62e-17	89.7	1213	0.030	0.043	SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.03c PE=3 SV=1
17	F4JAA5	8.32e-17	89.4	1347	0.035	0.044	SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana OX=3702 GN=SKI2 PE=1 SV=1
18	Q6P7X6	8.44e-17	89.4	1034	0.031	0.051	Q6P7X6_DANRE Superkiller viralicidic activity 2-like 2 OS=Danio rerio OX=7955 GN=skiv2l2 PE=1 SV=1
19	O14232	1.27e-16	89.0	1117	0.035	0.053	MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1
20	P42285	1.33e-16	88.6	1042	0.032	0.052	MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	1e-11	56.5	DEAD/DEAH box helicase
2	PF00271 Helicase_C	0.0078	27.9	Helicase conserved C-terminal domain
3	PF02562 PhoH	50	14.8	PhoH-like protein
4	PF04851 ResIII	2.7e-07	42.2	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260184

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247003	0.668	Probable ATP-dependent RNA helicase DDX49
2	9606.ENSP00000417401	0.645	Helicase with zinc finger domain 2
3	9606.ENSP00000343741	0.628	Serine/threonine-protein kinase ATR
4	9606.ENSP00000369335	0.627	F-box DNA helicase 1
5	9606.ENSP00000255078	0.622	DNA-binding protein SMUBP-2
6	9606.ENSP00000161863	0.621	Probable ATP-dependent RNA helicase YTHDC2
7	9606.ENSP00000358812	0.615	Protein RRP5 homolog
8	9606.ENSP00000362687	0.615	ATP-dependent RNA helicase DDX50
9	9606.ENSP00000366135	0.613	Exosome component 10
10	9606.ENSP00000377344	0.601	Probable ATP-dependent RNA helicase DDX60
11	9606.ENSP00000308179	0.592	WD repeat-containing protein 3
12	9606.ENSP00000368667	0.587	Probable ATP-dependent RNA helicase DDX53
13	9606.ENSP00000355541	0.580	HEAT repeat-containing protein 1
14	9606.ENSP00000405068	0.555	Nucleolar protein 14
15	9606.ENSP00000360215	0.548	Z-DNA-binding protein 1
16	9606.ENSP00000369213	0.531	Probable ATP-dependent RNA helicase DDX58
17	9606.ENSP00000481495	0.516	ATP-dependent RNA helicase DDX24
18	9606.ENSP00000446252	0.505	Superoxide dismutase [Mn], mitochondrial
19	9606.ENSP00000355890	0.500	Bifunctional glutamate/proline--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003723	0.997	RNA binding
GO:0003677	0.474	DNA binding
GO:0003824	0.463	catalytic activity
GO:0004386	0.437	helicase activity
GO:0140098	0.430	catalytic activity, acting on RNA
GO:0003724	0.379	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009615	0.974	response to virus
GO:0006950	0.913	response to stress
GO:0098542	0.605	defense response to other organism
GO:0065007	0.434	biological regulation
GO:0050789	0.424	regulation of biological process
GO:0009987	0.412	cellular process
GO:0008152	0.405	metabolic process
GO:0140546	0.370	defense response to symbiont
GO:0050794	0.318	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0005829	0.735	cytosol
GO:0043233	0.565	organelle lumen
GO:0031981	0.562	nuclear lumen
GO:0005654	0.453	nucleoplasm
GO:0005856	0.447	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.379	RNA helicase.

[back to server]