StarFunc result for job id Q5HY64

User Input

>input (1035 residues)
MGDQRPQDRPSSPGMDSTPWYCDKPPSKYFAKRKHRRLRFPPVDTQNWVFVTEGMDDFRY
GCQSPEDTLVCRRDEFLLPKISLRGPQADPKSRKKKLLKKAALFSKLSPAQPARKAFVEE
VEAQLMTKHPLAMYPNLGEDMPPDLLLQVLKPLDPERKLEDAGSCEGQEKTTDEPTEPGK
YPCGEFSPRPPETRVSCLPPEPPKTPVSSLRPEPPETGVSHLRPQPPKTQVSSLHLEPPE
TGVSHLRPEPPKTQVSSLHLEPPETGVSHLYLEPPGTGVSHLCPEPPKTRVSHLHREPPE
TGVPDLCLEPPKSRVSHLRPEPSETGVSHLHPEPPKTLVSSLHPEPPETGVSHLCPEPPE
TRVSPLRQLPPEAGVSHLCPEPPKTRVPPLRPETPKNGVSPLFPEPPKTRISNLRSEPPK
IGVSHLCLEPPKTRGSHLRPEPPETGVSHLRPEPPKTRVSSLHLEPPETGVSHLCPEPPE
KDVSHLRPEPPDTGVSHLCPEPPKTRVSHLRPEPSETGVSHLRPEPPKILVSSLHQAPPE
SSVSHLRPEPPETGVSHLRPEPPKTRMYSLRPEPPDTGVSHLCPEPPKTRVSSLPPEPPE
TGVSHLCPEPPETRVSHLRPEPPETGVSHLRPEPPKTRMYSLRPEPPNTGVSHLCPEPPK
TRVSSLPPEPPETGVSHLCPEPPETRVSHLRPEPPETGVSRLHPEPPKTRVSSLHAEPPE
SRVSHLCPEPPETGVSHLRPEPPKPRVSSLRPEPLETRVSHLRPEPPETGVSHLHPELPK
PRVSSLHLEPPKTRRVSSLRLEPPKTGRVSSLCPEPTKTGASHLKELFQEGTSSTMECVS
DSLQRRHTSRKLRDFKWAGDLGVNEESISSLFDFTPECRATYQDQKNKKANECSSGLKYS
MELDEMDEVKFFSQEKDLDGKIQNAPNSHSAQHVKMGYGAWYLKPKLGKKLRSDEPLIDP
KLVLEKPDEPDILDGLYGPIAFKDFILSKGYEMPGIIQRLFARRGWTYDSVKTPIQRAMQ
VYKYKEDVTDASEED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JRC9	0.072	0.083	1.272E-32	791	0.506	0.662	Q5JRC9.pdb.gz	FA47A_HUMAN Protein FAM47A OS=Homo sapiens OX=9606 GN=FAM47A PE=1 SV=3
2	AFDB:Q8NA70	0.084	0.126	4.039E-32	645	0.472	0.758	Q8NA70.pdb.gz	FA47B_HUMAN Protein FAM47B OS=Homo sapiens OX=9606 GN=FAM47B PE=1 SV=2
3	AFDB:Q6XPR3	0.049	0.058	1.364	784	0.088	0.116	Q6XPR3.pdb.gz	RPTN_HUMAN Repetin OS=Homo sapiens OX=9606 GN=RPTN PE=1 SV=1
4	AFDB:Q57ZU4	0.030	0.039	1.862	751	0.037	0.051	Q57ZU4.pdb.gz	Q57ZU4_TRYB2 IQ calmodulin-binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.730 PE=4 SV=1
5	AFDB:Q10180	0.030	0.081	1.946	326	0.024	0.077	Q10180.pdb.gz	MU113_SCHPO Meiotically up-regulated gene 113 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug113 PE=1 SV=1
6	PDB:4pexB	0.079	0.119	3.277	551	0.046	0.087	4pexB.pdb.gz	Active site and laminarin binding in glycoside hydrolase family 55.
7	PDB:3eh0A	0.056	0.099	4.279	341	0.016	0.050	3eh0A.pdb.gz
8	AFDB:P07548	0.039	0.062	4.527	586	0.031	0.055	P07548.pdb.gz	DFD_DROME Homeotic protein deformed OS=Drosophila melanogaster OX=7227 GN=Dfd PE=1 SV=2
9	AFDB:Q55FD8	0.083	0.051	4.527	1982	0.075	0.039	Q55FD8.pdb.gz	GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum OX=44689 GN=gefV PE=2 SV=1
10	AFDB:P46602	0.039	0.094	4.948	315	0.030	0.098	P46602.pdb.gz	HAT3_ARATH Homeobox-leucine zipper protein HAT3 OS=Arabidopsis thaliana OX=3702 GN=HAT3 PE=1 SV=2
11	AFDB:O16299	0.040	0.060	5.910	594	0.027	0.047	O16299.pdb.gz	FIGL1_CAEEL Fidgetin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=figl-1 PE=1 SV=1
12	AFDB:P16112	0.151	0.084	5.910	2530	0.141	0.058	P16112.pdb.gz	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
13	PDB:3foqA	0.057	0.092	8.331	439	0.020	0.048	3foqA.pdb.gz	Structure of N-acetylglucosamine-1-phosphate uridyltransferase (GlmU) from Mycobacterium tuberculosis in a cubic space group.
14	PDB:2oi6B	0.053	0.079	9.519	452	0.014	0.031	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JRC9	0.0	567	791	0.360	0.472	FA47A_HUMAN Protein FAM47A OS=Homo sapiens OX=9606 GN=FAM47A PE=1 SV=3
2	Q8NA70	0.0	583	645	0.312	0.501	FA47B_HUMAN Protein FAM47B OS=Homo sapiens OX=9606 GN=FAM47B PE=1 SV=2
3	Q6ZV65	2.81e-27	117	393	0.082	0.216	FA47E_HUMAN Protein FAM47E OS=Homo sapiens OX=9606 GN=FAM47E PE=1 SV=3
4	Q586F1	1.03e-06	55.5	1992	0.135	0.070	Q586F1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.305 PE=4 SV=1
5	Q9BZA7	2.19e-06	54.3	1347	0.035	0.027	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
6	Q9BZA8	4.89e-06	53.1	1340	0.035	0.027	PC11Y_HUMAN Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1
7	Q9UJ55	0.029	40.8	1249	0.072	0.060	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
8	Q586F2	0.28	37.7	1242	0.114	0.095	Q586F2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.300 PE=4 SV=1
9	Q57X74	0.48	36.6	574	0.115	0.207	Q57X74_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.670 PE=4 SV=1
10	Q389F6	0.93	35.8	405	0.065	0.165	Q389F6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1920 PE=4 SV=1
11	E9Q394	7.6	33.1	2776	0.042	0.015	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06346 Drf_FH1	0.016	26.5	Formin Homology Region 1
2	PF14642 FAM47	0	1145.8	FAM47 family
3	PF01716 MSP	8.8e+02	10.5	Manganese-stabilising protein / photosystem II polypeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367913

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000469337	0.671	Leucine-rich repeat-containing protein 63
2	9606.ENSP00000396747	0.654	Ankyrin repeat domain-containing protein 60
3	9606.ENSP00000366875	0.627	Spermatogenesis-associated protein 31A1
4	9606.ENSP00000382584	0.613	Keratin-associated protein 5-5
5	9606.ENSP00000308873	0.610	Coiled-coil domain containing 74B
6	9606.ENSP00000372201	0.601	Transmembrane protein 128
7	9606.ENSP00000367353	0.600	Uncharacterized protein C12orf42
8	9606.ENSP00000392252	0.580	Protein monoglycylase TTLL8
9	9606.ENSP00000359600	0.573	Outer dense fiber of sperm tails 2 like
10	9606.ENSP00000386166	0.572	Proline rich 21
11	9606.ENSP00000370420	0.562	Variable charge X-linked protein 3B
12	9606.ENSP00000358496	0.556	Cx9C motif-containing protein 4
13	9606.ENSP00000276127	0.528	CPX chromosome region, candidate 1
14	9606.ENSP00000321309	0.526	Variable charge X-linked protein 2
15	9606.ENSP00000318716	0.518	Protein FAM9B
16	9606.ENSP00000417330	0.517	Keratin-associated protein 5-7
17	9606.ENSP00000331556	0.512	Cylicin-1
18	9606.ENSP00000417182	0.505	Diffuse panbronchiolitis critical region 1
19	9606.ENSP00000329995	0.504	Protein FAM186A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.815	biological regulation
GO:0050789	0.805	regulation of biological process
GO:0050794	0.736	regulation of cellular process
GO:0009987	0.684	cellular process
GO:0071840	0.500	cellular component organization or biogenesis
GO:0016043	0.484	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005622	0.998	intracellular anatomical structure
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005737	0.897	cytoplasm
GO:0043227	0.747	membrane-bounded organelle
GO:0005856	0.608	cytoskeleton
GO:0043231	0.380	intracellular membrane-bounded organelle
GO:0015630	0.353	microtubule cytoskeleton
GO:0016020	0.348	membrane
GO:0005634	0.348	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]