StarFunc result for job id Q5HY98

User Input

>input (468 residues)
MAQLRRGHLTFRDVAIEFSQEEWKCLDPVQKALYRDVMLENYRNLVSLGICLPDLSIISM
MKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQLGLTFQLPLPE
LEIFQGEGKIYECNQVQKFISHSSSVSPLQRIYSGVKTHIFNKHRNDFVDFPLLSQEQKA
HIRRKPYECNEQGKVFRVSSSLPNHQVIHTADKPNRCHECGKTVRDKSGLAEHWRIRTGE
KPYKCKECGKLFNRIAYLARHEKVHTGESPYKCNECGKVFSRITYLVRHQKIHTREKPHK
CNKCGKVYSSSSYLAQHWRIHTGEKLYKCNKCGKEFSGHSSLTTHLLIHTGEKPYKCKEC
DKAFRHKFSLTVHQRNHNGEKPYKCHECGKVFTQVSHLARHQKIHTGEKPYKCNECGKVF
TQNSHLANHQRIHTGEKPYKCHVCGKVFRHSSWFVQHQRSVHERVLTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5HY98	1.000	1.000	2.780E-80	468	1.000	1.000	Q5HY98.pdb.gz	ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens OX=9606 GN=ZNF766 PE=1 SV=1
2	AFDB:Q8WV37	0.403	0.357	1.305E-50	535	0.628	0.550	Q8WV37.pdb.gz	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
3	AFDB:Q76KX8	0.373	0.277	5.808E-47	674	0.622	0.432	Q76KX8.pdb.gz	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
4	AFDB:F8WEZ9	0.466	0.446	6.086E-44	492	0.543	0.516	F8WEZ9.pdb.gz	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
5	AFDB:Q96HQ0	0.474	0.439	3.817E-43	510	0.447	0.410	Q96HQ0.pdb.gz	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
6	AFDB:Q96N58	0.487	0.397	4.266E-43	590	0.487	0.386	Q96N58.pdb.gz	ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=2
7	AFDB:Q7L2R6	0.399	0.364	4.510E-43	523	0.519	0.465	Q7L2R6.pdb.gz	ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens OX=9606 GN=ZNF765 PE=1 SV=2
8	AFDB:Q8TAF7	0.447	0.383	9.828E-43	563	0.451	0.375	Q8TAF7.pdb.gz	ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens OX=9606 GN=ZNF461 PE=1 SV=2
9	AFDB:Q16587	0.443	0.333	6.889E-42	644	0.404	0.293	Q16587.pdb.gz	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
10	AFDB:A6NHJ4	0.323	0.244	7.699E-42	632	0.528	0.391	A6NHJ4.pdb.gz	ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens OX=9606 GN=ZNF860 PE=1 SV=3
11	PDB:3w5kB	0.100	0.276	4.019E-4	110	0.077	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.037	0.210	6.572E-1	62	0.024	0.177	6ydhA.pdb.gz
13	PDB:5dkaA	0.063	0.232	8.680E-1	96	0.034	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:5n5yI	0.036	0.126	1.601	99	0.045	0.212	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
15	PDB:7pntO	0.059	0.105	1.601	197	0.062	0.147	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:6r5kO	0.082	0.084	1.692	447	0.053	0.056	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
17	PDB:6bk8O	0.059	0.089	1.789	229	0.041	0.083	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:5gm6a	0.042	0.124	2.000	123	0.058	0.220	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:7dvqM	0.048	0.094	2.114	191	0.064	0.157	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:6hlqI	0.035	0.130	2.235	111	0.036	0.153	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HY98	0.0	975	468	1.000	1.000	ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens OX=9606 GN=ZNF766 PE=1 SV=1
2	Q76KX8	0.0	550	674	0.598	0.415	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
3	Q8WV37	0.0	589	535	0.628	0.550	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
4	F8WEZ9	9.49e-180	514	492	0.573	0.545	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
5	A6NHJ4	2.91e-149	441	632	0.519	0.384	ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens OX=9606 GN=ZNF860 PE=1 SV=3
6	Q7L2R6	1.64e-147	433	523	0.524	0.468	ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens OX=9606 GN=ZNF765 PE=1 SV=2
7	Q96N58	1.22e-143	425	590	0.504	0.400	ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=2
8	P51522	3.30e-142	419	516	0.449	0.407	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
9	Q96JC4	1.44e-136	405	524	0.468	0.418	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
10	Q03923	8.77e-135	403	595	0.481	0.378	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
11	Q8NA42	1.55e-134	398	475	0.451	0.444	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
12	A2RRD8	9.04e-134	397	509	0.481	0.442	ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1
13	Q09FC8	2.80e-133	399	603	0.449	0.348	ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415 PE=1 SV=2
14	P35789	6.56e-133	399	620	0.472	0.356	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
15	Q03936	7.39e-133	397	586	0.464	0.370	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
16	Q2NKJ9	2.29e-132	395	569	0.470	0.387	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
17	Q96HQ0	4.63e-132	393	510	0.449	0.412	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
18	Q9H8G1	1.25e-130	391	570	0.470	0.386	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
19	Q8IYN0	1.59e-130	390	542	0.468	0.404	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
20	Q8TAQ5	1.02e-129	393	688	0.466	0.317	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	9e-05	33.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF18547 HalOD2	2.4e+02	13.0	Halobacterial output domain 2
3	PF01155 HypA	5.2	18.5	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
4	PF01352 KRAB	1.1e-22	90.7	KRAB box
5	PF10484 MRP-S23	0.18	23.5	Mitochondrial ribosomal protein S23
6	PF01286 XPA_N	0.0066	27.8	XPA protein N-terminal
7	PF01428 zf-AN1	31	16.1	AN1-like Zinc finger
8	PF00096 zf-C2H2	2.4e-48	171.1	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	4.8e-07	40.7	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	3.6e-23	91.3	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	0.00028	32.1	C2H2-type zinc finger
12	PF16278 zf-C2HE	3e+02	13.3	C2HE / C2H2 / C2HC zinc-binding finger
13	PF13465 zf-H2C2_2	3.1e-56	196.7	Zinc-finger double domain
14	PF01753 zf-MYND	5.3e+02	12.1	MYND finger
15	PF16744 zf-RING_15	9.4e+02	11.3	KIAA1045 RING finger
16	PF18439 zf_UBZ	9.4	17.3	Ubiquitin-Binding Zinc Finger
17	PF17032 zinc_ribbon_15	0.00011	34.2	zinc-ribbon family
18	PF09723 Zn-ribbon_8	1.4e-12	58.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409652

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269967	0.519	Coiled-coil domain containing 97

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.450	nucleic acid binding
GO:0003677	0.369	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031323	0.997	regulation of cellular metabolic process
GO:0080090	0.993	regulation of primary metabolic process
GO:0009889	0.993	regulation of biosynthetic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0010468	0.952	regulation of gene expression
GO:0006355	0.923	regulation of DNA-templated transcription
GO:0009987	0.802	cellular process
GO:0048519	0.751	negative regulation of biological process
GO:0048523	0.730	negative regulation of cellular process
GO:0006357	0.613	regulation of transcription by RNA polymerase II
GO:0071704	0.548	organic substance metabolic process
GO:0044238	0.545	primary metabolic process
GO:0051172	0.508	negative regulation of nitrogen compound metabolic process
GO:0031324	0.490	negative regulation of cellular metabolic process
GO:0010605	0.482	negative regulation of macromolecule metabolic process
GO:0045934	0.473	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.472	negative regulation of biosynthetic process
GO:1903507	0.455	negative regulation of nucleic acid-templated transcription
GO:0045892	0.446	negative regulation of DNA-templated transcription
GO:0044237	0.439	cellular metabolic process
GO:0050896	0.379	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.965	organelle lumen
GO:0070013	0.964	intracellular organelle lumen
GO:0031981	0.912	nuclear lumen
GO:0005737	0.855	cytoplasm
GO:0005654	0.815	nucleoplasm
GO:0005829	0.488	cytosol
GO:0043232	0.453	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]