StarFunc result for job id Q5HYA8

User Input

>input (995 residues)
MATRGGAGVAMAVWSLLSARAVTAFLLLFLPRFLQAQTFSFPFQQPEKCDNNQYFDISAL
SCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSD
LTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTFVNT
SRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVY
ANLTSCQALGNMCVMNMNSYDFATFDACGLFQFIFENTAGLSTVHSISFWRQNLPWLFYG
DQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQTLEGGVLQLCPDT
ETRLNAAYSFGTTYQQNCEIPISKILIDFPTPIFYDVYLEYTDENQHQYILAVPVLNLNL
QHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPNTIN
GNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEAHVQTDIALGVLGGLAVLASL
LKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLL
PMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPKGKVLKAVEGEGGVRS
ATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNP
PSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLL
SHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMR
QHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKL
LLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILA
SFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QB24	0.954	0.966	0.000	982	0.582	0.590	E9QB24.pdb.gz	E9QB24_DANRE Meckelin isoform X2 OS=Danio rerio OX=7955 GN=tmem67 PE=1 SV=1
2	AFDB:P0C152	0.921	0.924	0.000	992	0.839	0.842	P0C152.pdb.gz	MKS3_RAT Meckelin OS=Rattus norvegicus OX=10116 GN=Tmem67 PE=1 SV=1
3	AFDB:Q5HYA8	1.000	1.000	0.000	995	1.000	1.000	Q5HYA8.pdb.gz	MKS3_HUMAN Meckelin OS=Homo sapiens OX=9606 GN=TMEM67 PE=1 SV=2
4	AFDB:Q20046	0.779	0.859	1.413E-79	897	0.280	0.311	Q20046.pdb.gz	Q20046_CAEEL Meckelin OS=Caenorhabditis elegans OX=6239 GN=mks-3 PE=4 SV=2
5	AFDB:Q8VZJ5	0.075	0.113	1.535E-5	593	0.055	0.093	Q8VZJ5.pdb.gz	Q8VZJ5_ARATH AT5g08500/MAH20_6 OS=Arabidopsis thaliana OX=3702 GN=At5g23575 PE=1 SV=1
6	AFDB:Q9VYG3	0.082	0.123	1.995E-4	562	0.052	0.093	Q9VYG3.pdb.gz	Q9VYG3_DROME LD41462p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4332 PE=1 SV=1
7	AFDB:F4HW17	0.100	0.155	2.579E-4	589	0.070	0.119	F4HW17.pdb.gz	TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana OX=3702 GN=TMN5 PE=2 SV=1
8	AFDB:Q54ZW0	0.104	0.160	3.166E-4	587	0.083	0.141	Q54ZW0.pdb.gz	PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum OX=44689 GN=phg1b PE=2 SV=1
9	AFDB:O15321	0.113	0.172	3.508E-4	606	0.061	0.101	O15321.pdb.gz	TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 PE=2 SV=2
10	AFDB:Q9VMH0	0.106	0.150	4.772E-4	657	0.025	0.038	Q9VMH0.pdb.gz	TECT_DROME Tectonic OS=Drosophila melanogaster OX=7227 GN=tctn PE=1 SV=4
11	PDB:7rx3B	0.078	0.100	1.403E-2	591	0.049	0.083	7rx3B.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
12	PDB:6r7xA	0.086	0.118	8.029E-2	629	0.051	0.081	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
13	PDB:4xesA	0.073	0.116	8.897E-2	471	0.054	0.115	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
14	PDB:3uonA	0.110	0.199	1.412E-1	438	0.061	0.139	3uonA.pdb.gz	Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist.
15	PDB:4cy4E	0.069	0.164	1.564E-1	317	0.028	0.088	4cy4E.pdb.gz
16	PDB:4bbjA	0.077	0.100	1.825E-1	664	0.063	0.095	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
17	PDB:7rxgB	0.093	0.119	2.240E-1	650	0.048	0.074	7rxgB.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
18	PDB:7r5jR0	0.063	0.052	2.613E-1	1399	0.070	0.050	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:3jcfA	0.071	0.139	2.750E-1	349	0.036	0.103	3jcfA.pdb.gz
20	PDB:3pblA	0.103	0.164	2.750E-1	432	0.063	0.146	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QB24	0.0	1245	982	0.581	0.589	E9QB24_DANRE Meckelin isoform X2 OS=Danio rerio OX=7955 GN=tmem67 PE=1 SV=1
2	P0C152	0.0	1755	992	0.840	0.843	MKS3_RAT Meckelin OS=Rattus norvegicus OX=10116 GN=Tmem67 PE=1 SV=1
3	Q5HYA8	0.0	2071	995	1.000	1.000	MKS3_HUMAN Meckelin OS=Homo sapiens OX=9606 GN=TMEM67 PE=1 SV=2
4	Q8BR76	0.0	1778	992	0.850	0.853	MKS3_MOUSE Meckelin OS=Mus musculus OX=10090 GN=Tmem67 PE=1 SV=2
5	Q20046	7.05e-116	379	897	0.302	0.334	Q20046_CAEEL Meckelin OS=Caenorhabditis elegans OX=6239 GN=mks-3 PE=4 SV=2
6	A0A0S2Z5T9	5.50e-92	290	134	0.135	1.000	A0A0S2Z5T9_HUMAN Transmembrane protein 67 isoform 3 OS=Homo sapiens OX=9606 GN=TMEM67 PE=1 SV=1
7	M9NCR4	0.061	40.0	15105	0.039	0.003	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9NER8	0.061	40.0	15638	0.039	0.002	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PCJ8	0.061	40.0	14825	0.039	0.003	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PBZ4	0.065	40.0	18014	0.039	0.002	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PEH5	0.065	40.0	20710	0.039	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PEI1	0.065	40.0	21657	0.039	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PB30	0.066	40.0	22949	0.039	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
14	M9PC45	0.066	40.0	22300	0.039	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB32	0.072	39.7	19560	0.039	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PBZ0	0.072	39.7	22830	0.039	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PC41	0.072	39.7	22743	0.039	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC48	0.087	39.7	18095	0.039	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PCJ6	0.087	39.7	18641	0.039	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	P11047	0.091	39.3	1609	0.042	0.026	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09773 Meckelin	0	1175.3	Meckelin (Transmembrane protein 67)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376827	0.992	Meckel syndrome type 1 protein
2	9606.ENSP00000403465	0.991	Coiled-coil and C2 domain-containing protein 2A
3	9606.ENSP00000440638	0.987	Transmembrane protein 216
4	9606.ENSP00000356774	0.985	Jouberin
5	9606.ENSP00000448012	0.985	Centrosomal protein of 290 kDa
6	9606.ENSP00000304941	0.979	Tectonic-2
7	9606.ENSP00000261499	0.977	B9 domain-containing protein 1
8	9606.ENSP00000258173	0.973	Transmembrane protein 231
9	9606.ENSP00000380779	0.972	Tectonic-1
10	9606.ENSP00000243578	0.970	B9 domain-containing protein 2
11	9606.ENSP00000369257	0.960	Protein fantom
12	9606.ENSP00000350719	0.951	Nesprin-2
13	9606.ENSP00000483364	0.941	Tectonic-3
14	9606.ENSP00000335094	0.940	Transmembrane protein 17
15	9606.ENSP00000313169	0.935	Nephrocystin-1
16	9606.ENSP00000314116	0.889	Transmembrane protein 107
17	9606.ENSP00000367398	0.876	Nephrocystin-4
18	9606.ENSP00000338766	0.873	Nephrocystin-3
19	9606.ENSP00000358866	0.867	Filamin-A
20	9606.ENSP00000377769	0.821	ADP-ribosylation factor-like protein 13B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051082	0.989	unfolded protein binding
GO:0008092	0.961	cytoskeletal protein binding
GO:0031005	0.953	filamin binding
GO:0051787	0.930	misfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0071840	0.986	cellular component organization or biogenesis
GO:0016043	0.971	cellular component organization
GO:0032886	0.959	regulation of microtubule-based process
GO:0060271	0.952	cilium assembly
GO:0046605	0.927	regulation of centrosome cycle
GO:0010824	0.911	regulation of centrosome duplication
GO:0033043	0.840	regulation of organelle organization
GO:0051716	0.803	cellular response to stimulus
GO:0048523	0.801	negative regulation of cellular process
GO:0007154	0.773	cell communication
GO:0023052	0.672	signaling
GO:0051493	0.354	regulation of cytoskeleton organization
GO:0007165	0.323	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.999	cilium
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0030659	0.998	cytoplasmic vesicle membrane
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0005886	0.994	plasma membrane
GO:0005856	0.990	cytoskeleton
GO:0035869	0.975	ciliary transition zone
GO:0005813	0.944	centrosome
GO:0032991	0.942	protein-containing complex
GO:0005829	0.938	cytosol
GO:0098588	0.786	bounding membrane of organelle
GO:0098590	0.671	plasma membrane region
GO:0031253	0.630	cell projection membrane
GO:0060170	0.604	ciliary membrane
GO:0031981	0.331	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]