StarFunc result for job id Q5HYC2

User Input

>input (2103 residues)
MSVPGTPGAMEPAGEEERPPPAAEGEDDEEEVAAAAQTSGPAHGRSASSLEDADDQEEEM
EAMVIGGGCCKEQELTYELQQGYRILGEFLQEKHRGLTAPFLQPLGGVATAEEEVAEGPR
SGGRGGRAFPQQPGQGMCLLQMEEKFASGQYGGITEFVADFRLMLETCYRLHGVDHWISK
QGQKLEMMLEQKLALLSRHLREKTTIAVTSRGYYGLEDEKGTACTSTRRRSTPRSLAGLT
SGVFESIMVQVLRQEEQLRAKEEKRLREQERKEAEEASQKEIEEWERKLLAQAAPTCMET
MWEIPAIGHFLCLAQQILNLPEIVFYELERCLLMPQCNAFLSKIMTSLLSPPHRRPTLHR
RPTLPYRTWEAALRQKVQQWYTAVGQTENPDNCAEKLGLCPQFFKVLGEVNPLEEKPFHE
LPFYQKVWLLKGLCDFVYETQKEVQDAVLGQPIHECREVILGYDYLENAYVHFPQFCGAD
VRIYKQRPFQAPEFPIPPIKIQRVPRIKLEKLKCDYVSTSNGEHRCSRDSLPSSFKKEQE
NNFDPACCPAKMILDNHDISVEMGVKSNYEIRIRRPCEIKKTDCCKENLEKPRSPGEVTG
FGEPLSPGEIRFIENQEKYGEASRIKIEPSPLKENTLKSCQIHVNGSHSDHPEINCHKVV
RDILLEQSLQSHKKLKLTKMRAKKKKKKKKKLKDVLNENLQRKREGLHSLAFKSYKPEIQ
NKLLIIKKKAKHKKHKSGKKSVSKKAITKKRKTVIKSPTVPEFQLICTNLDELRELITKI
ENELKDLENSRKKSGKWYHRRQAVKELHSTLIRLLNELLPWEPKLMKAFQRNRSRLKKDY
DDFRRQPDHDTFNRELWTTDEGEGDLGKDSPKGEISKSIDSTEPLDILEKDHFDSDDMKL
SEIDFPMARSKLLKKELPSKDLPKTLLKTLKRQSKQTDYVDDSTKELSPRKKAKLSTNET
TVENLESDVQIDCFSESKHTEPSFPESFASLDSVPVSTLQKGTKPIQALLAKNIGNKVTL
TNQLPPSTGRNALAVEKPVLSPPEASPIKPALTCHTNTKGPLQMVYKMPCGQWLPIDLQN
SSVKIQVQPMVDPKTGEKIMQQVLILPKNFVIQHKEGKAVAKEVPPLQQKGTEQHCSSFP
QTTNINSSLASVFVNSPGTVSTQLPNTAFNKTITPLSNISSARPQPLSPVTSVSNLLTPS
VKTSQSEAGKAKNAVSAATFSLPSASPTISSTGQPLSSTTTLNGSTNPGSSFNCFAQQTA
DSSEAKQELKTVCIRDSQSILVRTRGGNTGVVKVQTNPDQNSPNTVSSSSVFTFAPQLQA
FLVPKSTTSSSAFSPVAGTTTTSSLSPFSQTPTSVSIPASFAPSMGKNLKLTLGHTTGSG
DLGHVIDKTSHMPSSPLKSSICSSTLLPSTTSSSVSVISISAANFGQNNANIIHTPTKQQ
QVDYITKSYPVTRSEATAATNGDVISGTPVQKLMLVSAPSILSSGNGTAINMTPALTSTG
VSAQKLVFINAPVPSGTSTPTLVAESLKQTLPPPLHKAYVKTPEQPQIVLIPSTVGTPIK
INSSPAVSQIKDVKIGLNIGQAIVNTSGTVPAIPSINILQNVTPKGEDKSSKGYILPLST
SGNSVPVSSNFVSQNITPVNESVVSSARAVNVLSVTGANLSLGSFPVTSASASAGAQPPV
LVSGNDTSSRIMPILSNRLCSSSLGNTVAISTVKTGHLASSVLISTTQPVVSPKCLTSAL
QIPVTVALPTPATTSPKIINTVPHSAAVPGATRSVSISKRQSRTSLQFHSPGISTTVPTN
VNTNKPQTELSSLSTSPGKITNTSNFASLPNQQALVKTPSYSSAPGGTTIHTASAPSNVT
SLVGSQFSEPCIQQKIVINTSTPLAPGTQIMINGTRFIVPPQGLGAGSHVLLISTNPKYG
APLVLNSGQGIQSTPIDNSAQKITLASNNSLSGQPLQHPLRSPTKFINSFGNASSIPTVH
TSPQLINTTAKVPVPPPVPTVSLTSVIKSPATLLAKTSLVSAICPSNPPLPSSTSVFHLD
PPVKKLLVSPEGAILNTINTPASKVSSLSPSLSQIVVSASRSPASVFPAFQSSGLEKPDR
AAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RCN2	0.081	0.111	8.005E-5	1502	0.126	0.177	F1RCN2.pdb.gz	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1
2	AFDB:Q8MSX1	0.031	0.034	9.748E-5	1818	0.118	0.137	Q8MSX1.pdb.gz	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
3	AFDB:E9Q2Z1	0.076	0.106	1.310E-4	1453	0.119	0.173	E9Q2Z1.pdb.gz	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
4	AFDB:Q10172	0.035	0.038	4.271E-4	1794	0.103	0.121	Q10172.pdb.gz	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
5	AFDB:Q8IY92	0.029	0.032	4.487E-4	1834	0.124	0.142	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
6	AFDB:Q8WYB5	0.028	0.028	4.713E-4	2073	0.094	0.095	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
7	AFDB:Q80U93	0.026	0.027	5.463E-4	2085	0.131	0.132	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
8	AFDB:A6NGG8	0.028	0.042	1.262E-3	1288	0.097	0.158	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
9	AFDB:Q8IXJ9	0.039	0.047	1.614E-3	1541	0.105	0.143	Q8IXJ9.pdb.gz	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
10	AFDB:P35658	0.030	0.030	1.966E-3	2090	0.130	0.131	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
11	PDB:1ddbA	0.027	0.183	2.070	195	0.013	0.138	1ddbA.pdb.gz
12	PDB:1yo7A	0.024	0.371	2.284	120	0.004	0.067	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
13	PDB:6thaA	0.028	0.085	2.648	448	0.010	0.047	6thaA.pdb.gz
14	PDB:4v6wCh	0.021	0.297	2.922	123	0.007	0.114	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:5uwuC	0.028	0.050	2.922	998	0.024	0.051	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
16	PDB:6wgg2	0.019	0.061	3.558	581	0.005	0.019	6wgg2.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
17	PDB:6ql7M	0.017	0.189	3.737	113	0.009	0.159	6ql7M.pdb.gz
18	PDB:4kncB	0.018	0.070	4.332	419	0.004	0.021	4kncB.pdb.gz
19	PDB:5afqB	0.022	0.079	4.781	444	0.006	0.029	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
20	PDB:6tuyA	0.026	0.070	4.781	667	0.005	0.016	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RCN2	3.94e-10	68.2	1502	0.026	0.037	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1
2	E9Q2Z1	4.75e-07	57.8	1453	0.024	0.035	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
3	Q9BXF3	1.09e-06	56.6	1484	0.024	0.034	CECR2_HUMAN Chromatin remodeling regulator CECR2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2
4	F1QQP6	6.38e-06	53.9	683	0.022	0.067	F1QQP6_DANRE Bromodomain-containing 3a OS=Danio rerio OX=7955 GN=brd3 PE=1 SV=1
5	U3KQA6	4.94e-05	50.8	552	0.015	0.058	U3KQA6_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
6	P25440	5.96e-05	50.8	801	0.016	0.041	BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2
7	Q7JJ13	6.00e-05	50.8	798	0.016	0.041	BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus OX=10090 GN=Brd2 PE=1 SV=1
8	P13709	6.80e-05	50.8	2038	0.015	0.015	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
9	H0Y6K2	7.83e-05	50.4	807	0.016	0.041	H0Y6K2_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
10	Q9ESU6	2.35e-04	48.9	1400	0.015	0.022	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
11	O60885	2.52e-04	48.9	1362	0.015	0.023	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
12	F1R5H6	3.71e-04	48.5	1444	0.010	0.014	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
13	Q15059	4.92e-04	47.8	726	0.020	0.059	BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1
14	Q58F21	0.001	46.6	947	0.014	0.032	BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens OX=9606 GN=BRDT PE=1 SV=4
15	Q91Y44	0.002	45.4	956	0.015	0.032	BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus OX=10090 GN=Brdt PE=1 SV=3
16	A8CYR1	0.004	44.7	836	0.014	0.035	A8CYR1_DANRE Bromodomain-containing 2a OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
17	Q1LWX7	0.004	44.7	832	0.014	0.035	Q1LWX7_DANRE Bromodomain-containing 2 OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
18	Q9HGP4	0.004	45.1	727	0.016	0.045	YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC631.02 PE=1 SV=3
19	D4A7T3	0.005	44.7	952	0.015	0.034	BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus OX=10116 GN=Brdt PE=1 SV=1
20	A3QMC6	0.052	40.4	312	0.018	0.122	ERLN_CAEEL Erlin OS=Caenorhabditis elegans OX=6239 GN=erl-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	0.11	23.9	Bromodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359698	0.801	Ubiquitin domain-containing protein 1
2	9606.ENSP00000390778	0.619	Meiosis-specific with OB domain-containing protein
3	9606.ENSP00000261326	0.561	Molybdenum cofactor sulfurase
4	9606.ENSP00000264734	0.536	Claudin-16
5	9606.ENSP00000365160	0.518	Diphosphoinositol polyphosphate phosphohydrolase 3-beta
6	9606.ENSP00000333915	0.517	Cilia- and flagella-associated protein 73
7	9606.ENSP00000355306	0.504	UPF0688 protein C1orf174

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.675	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050789	0.886	regulation of biological process
GO:0019222	0.717	regulation of metabolic process
GO:0060255	0.692	regulation of macromolecule metabolic process
GO:0050794	0.645	regulation of cellular process
GO:0071704	0.623	organic substance metabolic process
GO:0044238	0.619	primary metabolic process
GO:0006807	0.572	nitrogen compound metabolic process
GO:0043170	0.470	macromolecule metabolic process
GO:1901564	0.405	organonitrogen compound metabolic process
GO:0044237	0.310	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.979	nuclear lumen
GO:0005654	0.974	nucleoplasm
GO:0005737	0.934	cytoplasm
GO:0043232	0.831	intracellular non-membrane-bounded organelle
GO:0005829	0.751	cytosol
GO:0005694	0.501	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]