StarFunc result for job id Q5HYI8

User Input

>input (236 residues)
MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTY
YIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVP
TGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAFLAEDFNPEEINLDC
TNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5HYI8	1.000	1.000	3.801E-49	236	1.000	1.000	Q5HYI8.pdb.gz	RABL3_HUMAN Rab-like protein 3 OS=Homo sapiens OX=9606 GN=RABL3 PE=1 SV=1
2	PDB:6vijB	0.790	0.973	7.662E-33	191	0.763	0.942	6vijB.pdb.gz	Genetic and structural studies of RABL3 reveal an essential role in lymphoid development and function.
3	AFDB:Q9C5J9	0.611	0.434	1.108E-14	342	0.280	0.193	Q9C5J9.pdb.gz	LIIP1_ARATH Small GTPase LIP1 OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
4	AFDB:O95755	0.610	0.443	1.158E-13	333	0.199	0.141	O95755.pdb.gz	RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens OX=9606 GN=RAB36 PE=1 SV=2
5	AFDB:Q498P3	0.603	0.596	1.158E-13	239	0.208	0.205	Q498P3.pdb.gz	Q498P3_DANRE RAB33B, member RAS oncogene family a OS=Danio rerio OX=7955 GN=zgc:114080 PE=1 SV=1
6	AFDB:F1LW77	0.598	0.614	2.689E-13	229	0.216	0.223	F1LW77.pdb.gz	F1LW77_RAT RAB33B, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab33b PE=3 SV=2
7	AFDB:F1PTE3	0.638	0.730	3.033E-13	203	0.208	0.241	F1PTE3.pdb.gz	RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris OX=9615 GN=RAB13 PE=1 SV=2
8	AFDB:C0H516	0.602	0.681	3.632E-13	206	0.191	0.218	C0H516.pdb.gz	C0H516_PLAF7 Ras-related protein RAB7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0903200 PE=4 SV=1
9	AFDB:Q9DD03	0.636	0.726	5.212E-13	202	0.212	0.248	Q9DD03.pdb.gz	RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus OX=10090 GN=Rab13 PE=1 SV=1
10	AFDB:P36411	0.618	0.708	5.535E-13	203	0.199	0.232	P36411.pdb.gz	RAB7A_DICDI Ras-related protein Rab-7a OS=Dictyostelium discoideum OX=44689 GN=rab7A PE=1 SV=1
11	AFDB:O04157	0.580	0.660	5.878E-13	203	0.212	0.246	O04157.pdb.gz	RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana OX=3702 GN=RABG3B PE=1 SV=1
12	PDB:1zbdA	0.567	0.735	2.761E-11	177	0.165	0.220	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
13	PDB:5szhB	0.585	0.764	5.040E-11	175	0.178	0.240	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:6if2B	0.584	0.756	5.684E-11	178	0.186	0.247	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
15	PDB:2zetA	0.598	0.762	6.809E-11	181	0.191	0.249	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
16	PDB:8a4cB	0.567	0.762	6.809E-11	170	0.157	0.218	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
17	PDB:5sziA	0.594	0.786	1.170E-10	174	0.174	0.236	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
18	PDB:2f9mA	0.539	0.676	1.402E-10	182	0.186	0.242	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
19	PDB:6s5hA	0.569	0.749	1.488E-10	175	0.161	0.217	6s5hA.pdb.gz	Structure of the human RAB38 in complex with GTP
20	PDB:5c2kA	0.598	0.382	1.679E-10	382	0.119	0.073	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HYI8	7.85e-178	489	236	1.000	1.000	RABL3_HUMAN Rab-like protein 3 OS=Homo sapiens OX=9606 GN=RABL3 PE=1 SV=1
2	Q9D4V7	1.13e-162	451	236	0.924	0.924	RABL3_MOUSE Rab-like protein 3 OS=Mus musculus OX=10090 GN=Rabl3 PE=1 SV=1
3	Q9C5J9	1.34e-22	96.3	342	0.288	0.199	LIIP1_ARATH Small GTPase LIP1 OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
4	Q9W5X0	4.44e-12	65.1	201	0.174	0.204	Q9W5X0_DROME LD21953p OS=Drosophila melanogaster OX=7227 GN=Rab35 PE=1 SV=1
5	O18337	1.29e-11	63.9	197	0.195	0.234	O18337_DROME Rab-related protein 4 OS=Drosophila melanogaster OX=7227 GN=Rab18 PE=2 SV=1
6	Q9W4A0	8.45e-11	61.6	197	0.191	0.228	Q9W4A0_DROME GH11193p OS=Drosophila melanogaster OX=7227 GN=Rab18 PE=1 SV=1
7	D6XLJ6	9.81e-11	61.6	218	0.174	0.188	D6XLJ6_TRYB2 Small GTP-binding protein Rab1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.220 PE=4 SV=1
8	O02591	9.81e-11	61.6	218	0.174	0.188	O02591_9TRYP Rab1 protein OS=Trypanosoma brucei OX=5691 GN=rab1 PE=4 SV=1
9	C0H516	1.12e-10	61.2	206	0.216	0.248	C0H516_PLAF7 Ras-related protein RAB7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0903200 PE=4 SV=1
10	C8VQY7	1.94e-10	60.5	205	0.199	0.229	YPT7_EMENI Ypt/Rab-type GTPase avaA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=avaA PE=1 SV=1
11	Q95UJ0	3.20e-10	60.1	206	0.199	0.228	RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia OX=43137 GN=Rab7a PE=1 SV=2
12	Q6DUB4	3.56e-10	60.1	206	0.199	0.228	RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia OX=43137 GN=Rab7b PE=1 SV=1
13	Q9U2C3	6.26e-10	59.3	209	0.161	0.182	Q9U2C3_CAEEL Ras-related protein Rab-35 OS=Caenorhabditis elegans OX=6239 GN=rab-35 PE=1 SV=1
14	Q15286	2.41e-09	57.4	201	0.220	0.259	RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens OX=9606 GN=RAB35 PE=1 SV=1
15	Q5U316	2.41e-09	57.4	201	0.220	0.259	RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1
16	Q6PHN9	2.41e-09	57.4	201	0.220	0.259	RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus OX=10090 GN=Rab35 PE=1 SV=1
17	Q9DD03	3.06e-09	57.4	202	0.131	0.153	RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus OX=10090 GN=Rab13 PE=1 SV=1
18	A0A2H3HA93	3.11e-09	57.4	205	0.178	0.205	A0A2H3HA93_GIBZA Uncharacterized protein OS=Gibberella zeae OX=5518 GN=FUG_LOCUS89406 PE=4 SV=1
19	P51153	3.22e-09	57.0	203	0.131	0.153	RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens OX=9606 GN=RAB13 PE=1 SV=1
20	P11620	3.25e-09	57.0	203	0.148	0.172	YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.6e+02	12.4	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	3.3	19.6	AAA ATPase domain
3	PF13555 AAA_29	72	14.6	P-loop containing region of AAA domain
4	PF07728 AAA_5	1.4e+02	13.8	AAA domain (dynein-related subfamily)
5	PF00005 ABC_tran	97	14.9	ABC transporter
6	PF00025 Arf	0.0053	27.7	ADP-ribosylation factor family
7	PF05673 DUF815	2.2e+02	12.3	Protein of unknown function (DUF815)
8	PF01935 DUF87	1.8e+02	13.6	Helicase HerA, central domain
9	PF04670 Gtr1_RagA	0.00061	30.8	Gtr1/RagA G protein conserved region
10	PF05049 IIGP	18	15.9	Interferon-inducible GTPase (IIGP)
11	PF01926 MMR_HSR1	0.0043	28.5	50S ribosome-binding GTPase
12	PF00071 Ras	3.7e-10	51.1	Ras family
13	PF00910 RNA_helicase	5.7e+02	12.3	RNA helicase
14	PF08477 Roc	7.1e-12	57.0	Ras of Complex, Roc, domain of DAPkinase
15	PF03193 RsgA_GTPase	1.6	20.1	RsgA GTPase
16	PF00735 Septin	1.2e+02	13.4	Septin
17	PF00158 Sigma54_activat	3.3e+02	12.4	Sigma-54 interaction domain
18	PF09439 SRPRB	1.1e+02	13.7	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340454	0.861	Rap1 GTPase-GDP dissociation stimulator 1
2	9606.ENSP00000393541	0.669	Intraflagellar transport protein 27 homolog
3	9606.ENSP00000301463	0.663	SPRY domain containing 3
4	9606.ENSP00000320084	0.648	CD276 antigen
5	9606.ENSP00000356465	0.629	Ras-related protein Rab-32
6	9606.ENSP00000283871	0.608	Homogentisate 1,2-dioxygenase
7	9606.ENSP00000366673	0.595	Ceroid-lipofuscinosis neuronal protein 5
8	9606.ENSP00000442478	0.594	Stomatin-like protein 1
9	9606.ENSP00000320359	0.586	Intraflagellar transport protein 22 homolog
10	9606.ENSP00000013807	0.576	DNA excision repair protein ERCC-1
11	9606.ENSP00000356231	0.571	Guanine nucleotide exchange factor MSS4
12	9606.ENSP00000355319	0.560	CLOCK-interacting pacemaker
13	9606.ENSP00000284274	0.545	Ubiquitin thioesterase otulin
14	9606.ENSP00000433126	0.532	Transmembrane protein 41B
15	9606.ENSP00000461785	0.516	Ras-related protein Rab-40B
16	9606.ENSP00000360727	0.505	Rab-like protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.988	protein binding
GO:0019001	0.917	guanyl nucleotide binding
GO:0032561	0.871	guanyl ribonucleotide binding
GO:0005525	0.837	GTP binding
GO:0003924	0.581	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.984	biological regulation
GO:0050789	0.971	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0019222	0.795	regulation of metabolic process
GO:0060255	0.756	regulation of macromolecule metabolic process
GO:0031323	0.719	regulation of cellular metabolic process
GO:0051171	0.679	regulation of nitrogen compound metabolic process
GO:0080090	0.666	regulation of primary metabolic process
GO:0032501	0.663	multicellular organismal process
GO:0051056	0.650	regulation of small GTPase mediated signal transduction
GO:0051246	0.531	regulation of protein metabolic process
GO:0031326	0.512	regulation of cellular biosynthetic process
GO:0010556	0.511	regulation of macromolecule biosynthetic process
GO:2000112	0.500	regulation of cellular macromolecule biosynthetic process
GO:0071840	0.478	cellular component organization or biogenesis
GO:0048518	0.422	positive regulation of biological process
GO:0016043	0.374	cellular component organization
GO:0032502	0.360	developmental process
GO:0050896	0.349	response to stimulus
GO:0051179	0.328	localization
GO:0048856	0.323	anatomical structure development
GO:0046578	0.312	regulation of Ras protein signal transduction
GO:0006996	0.303	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0005634	0.987	nucleus
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0016020	0.831	membrane
GO:0005829	0.812	cytosol
GO:0070013	0.467	intracellular organelle lumen
GO:0012505	0.402	endomembrane system
GO:0015630	0.329	microtubule cytoskeleton
GO:0042995	0.328	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.581	GTP + H2O = GDP + H(+) + phosphate

[back to server]