StarFunc result for job id Q5HYK3

User Input

>input (327 residues)
MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVS
EEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDI
AFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVG
KQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGG
RFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDM
IEDAGFHKVTYESLTSGIVAIHSGFKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5HYK3	1.000	1.000	1.644E-64	327	1.000	1.000	Q5HYK3.pdb.gz	COQ5_HUMAN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2
2	AFDB:Q9CXI0	0.879	0.879	5.792E-57	327	0.838	0.838	Q9CXI0.pdb.gz	COQ5_MOUSE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq5 PE=1 SV=2
3	AFDB:Q9LVC8	0.748	0.848	1.093E-36	288	0.508	0.576	Q9LVC8.pdb.gz	COQ5_ARATH 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ5 PE=2 SV=1
4	AFDB:P34666	0.732	0.838	1.339E-34	285	0.410	0.470	P34666.pdb.gz	COQ5_CAEEL 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-5 PE=3 SV=2
5	AFDB:P87230	0.743	0.796	3.853E-33	305	0.431	0.462	P87230.pdb.gz	COQ5_SCHPO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq5 PE=3 SV=1
6	AFDB:P49017	0.740	0.787	9.735E-33	307	0.413	0.440	P49017.pdb.gz	COQ5_YEAST 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ5 PE=1 SV=1
7	AFDB:P0A887	0.743	0.963	3.101E-32	251	0.376	0.490	P0A887.pdb.gz	UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) OX=83333 GN=ubiE PE=1 SV=1
8	AFDB:Q383M8	0.692	0.782	1.031E-28	288	0.361	0.410	Q383M8.pdb.gz	Q383M8_TRYB2 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2280 PE=3 SV=1
9	AFDB:P9WFR3	0.629	0.869	3.144E-23	234	0.257	0.359	P9WFR3.pdb.gz	MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=menG PE=1 SV=1
10	AFDB:Q3ED65	0.649	0.805	6.870E-21	261	0.229	0.287	Q3ED65.pdb.gz	MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MENG PE=1 SV=2
11	PDB:5f8cB	0.415	0.377	5.693E-12	363	0.128	0.116	5f8cB.pdb.gz
12	PDB:5m58A	0.519	0.712	1.711E-11	230	0.113	0.161	5m58A.pdb.gz	Crystal Structure and Catalytic Mechanism of CouO, a Versatile C-Methyltransferase from Streptomyces rishiriensis.
13	PDB:5mgzA	0.468	0.644	1.813E-11	230	0.128	0.183	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
14	PDB:5wp5A	0.452	0.326	6.485E-11	463	0.125	0.089	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
15	PDB:5wp4A	0.448	0.308	1.300E-10	485	0.125	0.085	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
16	PDB:4kdcA	0.452	0.647	2.760E-10	217	0.116	0.175	4kdcA.pdb.gz
17	PDB:4iwnA	0.485	0.671	4.139E-10	229	0.125	0.179	4iwnA.pdb.gz	S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
18	PDB:4ineA	0.456	0.351	5.219E-10	431	0.104	0.079	4ineA.pdb.gz	Crystal structure of N-methyl transferase (PMT-2) from Caenorhabditis elegant complexed with S-adenosyl homocysteine and phosphoethanolamine
19	PDB:1qzzA	0.381	0.368	3.143E-9	340	0.110	0.106	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
20	PDB:4a6dA	0.409	0.390	6.675E-9	345	0.131	0.125	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HYK3	0.0	679	327	1.000	1.000	COQ5_HUMAN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2
2	Q9CXI0	0.0	542	327	0.838	0.838	COQ5_MOUSE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq5 PE=1 SV=2
3	Q9LVC8	2.26e-105	311	288	0.498	0.566	COQ5_ARATH 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ5 PE=2 SV=1
4	P34666	2.33e-81	250	285	0.407	0.467	COQ5_CAEEL 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-5 PE=3 SV=2
5	P87230	1.46e-80	249	305	0.410	0.439	COQ5_SCHPO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq5 PE=3 SV=1
6	P0A887	1.22e-75	234	251	0.376	0.490	UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) OX=83333 GN=ubiE PE=1 SV=1
7	P49017	1.45e-72	228	307	0.422	0.450	COQ5_YEAST 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ5 PE=1 SV=1
8	Q383M8	2.03e-65	209	288	0.358	0.406	Q383M8_TRYB2 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2280 PE=3 SV=1
9	P9WFR3	2.59e-42	148	234	0.266	0.372	MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=menG PE=1 SV=1
10	Q3ED65	1.85e-27	110	261	0.223	0.280	MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MENG PE=1 SV=2
11	Q9TYP1	3.92e-08	56.2	334	0.070	0.069	STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans OX=6239 GN=strm-1 PE=1 SV=2
12	O53285	1.11e-06	52.0	327	0.086	0.086	O53285_MYCTO Methyltransferase type 11 domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3123 PE=4 SV=1
13	P9WIN3	2.67e-06	50.4	270	0.086	0.104	PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2952 PE=1 SV=1
14	A0A1D8PSY8	9.56e-06	48.9	303	0.125	0.135	A0A1D8PSY8_CANAL Crg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRG1 PE=4 SV=1
15	H6UNZ8	2.67e-05	47.4	297	0.125	0.138	H6UNZ8_STRCW Herf OS=Streptomyces chromofuscus OX=42881 GN=herF PE=4 SV=1
16	Q9LY74	1.36e-04	45.4	338	0.125	0.121	BQMT_ARATH 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VTE3 PE=1 SV=1
17	A2APY7	0.002	42.4	343	0.138	0.131	NDUF5_MOUSE Arginine-hydroxylase NDUFAF5, mitochondrial OS=Mus musculus OX=10090 GN=Ndufaf5 PE=1 SV=1
18	Q5TEU4	0.002	41.6	345	0.058	0.055	NDUF5_HUMAN Arginine-hydroxylase NDUFAF5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF5 PE=1 SV=1
19	P12999	0.009	39.7	251	0.070	0.092	BIOC_ECOLI Malonyl-[acyl-carrier protein] O-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=bioC PE=1 SV=2
20	A0A1D8PLX3	0.013	39.7	444	0.104	0.077	A0A1D8PLX3_CANAL RNA methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C403780CA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	9.6e-14	63.1	Methyltransferase domain
2	PF08242 Methyltransf_12	1.6e-05	36.9	Methyltransferase domain
3	PF12147 Methyltransf_20	89	13.7	Putative methyltransferase
4	PF13489 Methyltransf_23	0.00038	31.8	Methyltransferase domain
5	PF13649 Methyltransf_25	4.1e-14	64.4	Methyltransferase domain
6	PF13847 Methyltransf_31	1.9e-09	49.0	Methyltransferase domain
7	PF05148 Methyltransf_8	0.93	20.9	Hypothetical methyltransferase
8	PF01209 Ubie_methyltran	5.6e-89	309.0	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333946	0.997	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
2	9606.ENSP00000322316	0.996	5-demethoxyubiquinone hydroxylase, mitochondrial
3	9606.ENSP00000254759	0.990	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
4	9606.ENSP00000300452	0.989	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
5	9606.ENSP00000365388	0.984	Decaprenyl-diphosphate synthase subunit 1
6	9606.ENSP00000262507	0.974	Ubiquinone biosynthesis protein COQ9, mitochondrial
7	9606.ENSP00000355741	0.970	Atypical kinase COQ8A, mitochondrial
8	9606.ENSP00000358033	0.958	Decaprenyl-diphosphate synthase subunit 2
9	9606.ENSP00000315118	0.953	Atypical kinase COQ8B, mitochondrial
10	9606.ENSP00000310873	0.945	4-hydroxybenzoate polyprenyltransferase, mitochondrial
11	9606.ENSP00000249269	0.807	Mitochondrial-processing peptidase subunit beta
12	9606.ENSP00000203407	0.773	Cytochrome b-c1 complex subunit 1, mitochondrial
13	9606.ENSP00000381473	0.766	HIG1 hypoxia inducible domain family member 1C
14	9606.ENSP00000282841	0.748	Geranylgeranyl pyrophosphate synthase
15	9606.ENSP00000072869	0.740	Uncharacterized aarF domain-containing protein kinase 2
16	9606.ENSP00000426638	0.714	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
17	9606.ENSP00000312587	0.697	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
18	9606.ENSP00000016171	0.695	Cytochrome c oxidase assembly protein COX15 homolog
19	9606.ENSP00000263960	0.661	Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
20	9606.ENSP00000306397	0.655	Cytochrome b-c1 complex subunit Rieske, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008169	1.000	C-methyltransferase activity
GO:0043333	0.776	2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006744	0.990	ubiquinone biosynthetic process
GO:0032259	0.922	methylation
GO:0044238	0.320	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.969	intracellular organelle lumen
GO:0016020	0.951	membrane
GO:0032991	0.882	protein-containing complex
GO:0031090	0.872	organelle membrane
GO:0031966	0.850	mitochondrial membrane
GO:0019866	0.788	organelle inner membrane
GO:0005743	0.784	mitochondrial inner membrane
GO:0005759	0.570	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
EC:2.1.1.201	0.776	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase.

[back to server]