StarFunc result for job id Q5HYK9

User Input

>input (610 residues)
MPSARGKSKSKAPITFGDLAIYFSQEEWEWLSPIQKDLYEDVMLENYRNLVSLGLSFRRP
NVITLLEKGKAPWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPT
RKSGCNKNSVLVKPKKGHSGKKPLKCNDCGKTFSRSFSLKLHQNIHTGEKPFECSNCRKA
FRQISSILLHQRIHSGKKSHECNKCGESFNQRTTLILHMRIHDGKEILDCGKALSQCQSF
NIHQKIHVVGNVCQCRKCGKAFNQMSSLLLHKKIHNGKKTHKYNKCGRGFKKKSVFVVHK
RIHAGEKIPENAKALSQSLQQRSHHLENPFKCRKCGKLFNRISPLMLHQRIHTSEKPYKC
DKCDKFFRRLSTLILHLRIHNGEKLYRCNKCEKVCNRHSSLIQHQKVHTKKKKLFECKEC
GKMFSGTANLKIHQNIHSEEKPFKCNKCSKVFGRQSFLIEHQRIHTGEKPYQCEECGKAF
SHRISLTRHKRIHTEDRPYECDQCGKAFSQSAHLAQHERIHTGEKPYTCKTCGKAFSQRT
SLILHERSHTGEKPYECNECGKAFSSGSDLIRHQRSHSSEKPYECSKCGKAYSRSSSLIR
HQNTHSEEKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5HYK9	1.000	1.000	3.676E-99	610	1.000	1.000	Q5HYK9.pdb.gz	ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens OX=9606 GN=ZNF667 PE=1 SV=2
2	AFDB:Q5MCW4	0.343	0.309	7.390E-54	686	0.469	0.417	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
3	AFDB:Q6ECI4	0.329	0.284	7.506E-53	717	0.472	0.402	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
4	AFDB:Q9P2J8	0.340	0.248	3.218E-52	865	0.456	0.321	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
5	AFDB:Q9BX82	0.336	0.328	2.365E-51	626	0.439	0.428	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
6	AFDB:O75290	0.330	0.316	4.516E-51	641	0.454	0.432	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
7	AFDB:Q8NDQ6	0.331	0.308	6.951E-51	660	0.448	0.414	Q8NDQ6.pdb.gz	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
8	AFDB:Q14587	0.336	0.226	1.647E-50	947	0.434	0.280	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
9	AFDB:P52742	0.314	0.293	3.902E-50	658	0.452	0.419	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
10	AFDB:Q06732	0.327	0.262	1.423E-49	778	0.433	0.339	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
11	PDB:3w5kB	0.081	0.268	2.953E-4	110	0.070	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.037	0.202	6.946E-1	62	0.025	0.242	6ydhA.pdb.gz
13	PDB:7ena4	0.071	0.080	1.326	457	0.098	0.131	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:5dkaA	0.043	0.167	1.400	96	0.026	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7ns4b	0.069	0.101	1.477	340	0.087	0.156	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
16	PDB:6bk8O	0.052	0.103	1.737	229	0.036	0.096	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:4kfzB	0.055	0.160	2.042	148	0.030	0.122	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:7o4iW	0.042	0.071	2.155	312	0.046	0.090	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:7qooK	0.071	0.116	2.400	253	0.059	0.142	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
20	PDB:6f40P	0.056	0.094	2.673	246	0.033	0.081	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HYK9	0.0	1246	610	1.000	1.000	ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens OX=9606 GN=ZNF667 PE=1 SV=2
2	Q8TAQ5	0.0	535	688	0.480	0.426	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
3	Q5MCW4	4.46e-176	517	686	0.474	0.421	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
4	O75290	7.83e-170	499	641	0.462	0.440	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
5	Q96SK3	5.00e-168	497	696	0.452	0.397	ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens OX=9606 GN=ZNF607 PE=1 SV=3
6	Q8BLA2	1.90e-163	481	578	0.410	0.433	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
7	Q7TMN8	2.08e-163	481	578	0.410	0.433	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
8	A6NNF4	2.37e-163	482	616	0.439	0.435	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
9	Q9P2J8	4.73e-163	489	865	0.443	0.312	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
10	P35789	1.08e-162	481	620	0.448	0.440	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
11	Q8IYB9	8.30e-162	479	648	0.444	0.418	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
12	P52742	2.27e-161	478	658	0.449	0.416	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
13	Q6ECI4	2.11e-160	478	717	0.443	0.377	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
14	Q03923	8.79e-160	472	595	0.426	0.437	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
15	P51523	5.48e-158	473	738	0.457	0.378	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
16	A0A0U1RQ46	5.51e-158	468	609	0.411	0.412	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
17	Q02386	5.71e-158	471	682	0.446	0.399	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
18	P15620	9.83e-158	466	580	0.384	0.403	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
19	Q9BX82	3.14e-156	464	626	0.425	0.414	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
20	Q7Z3V5	5.54e-156	463	609	0.434	0.435	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	6.1e-19	78.7	KRAB box
2	PF10484 MRP-S23	1.2	20.8	Mitochondrial ribosomal protein S23
3	PF00096 zf-C2H2	8.4e-72	245.0	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	0.023	25.7	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	1.8e-32	120.2	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	8.6e-09	46.4	C2H2-type zinc finger
7	PF15909 zf-C2H2_8	0.046	25.4	C2H2-type zinc ribbon
8	PF12171 zf-C2H2_jaz	2.8e-06	38.7	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	1.7e-89	301.9	Zinc-finger double domain
10	PF18439 zf_UBZ	4.9e+02	11.8	Ubiquitin-Binding Zinc Finger
11	PF17032 zinc_ribbon_15	0.75	21.9	zinc-ribbon family
12	PF09723 Zn-ribbon_8	7e-07	40.6	Zinc ribbon domain
13	PF17283 Zn_ribbon_SprT	72	14.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419153	0.501	Zinc finger and BTB domain-containing protein 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0019219	0.982	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.967	regulation of biosynthetic process
GO:0010468	0.944	regulation of gene expression
GO:0006355	0.927	regulation of DNA-templated transcription
GO:0048519	0.923	negative regulation of biological process
GO:0009892	0.841	negative regulation of metabolic process
GO:0048523	0.835	negative regulation of cellular process
GO:0010605	0.765	negative regulation of macromolecule metabolic process
GO:0051172	0.728	negative regulation of nitrogen compound metabolic process
GO:0006357	0.640	regulation of transcription by RNA polymerase II
GO:0031324	0.623	negative regulation of cellular metabolic process
GO:1903507	0.606	negative regulation of nucleic acid-templated transcription
GO:0045892	0.604	negative regulation of DNA-templated transcription
GO:0009987	0.589	cellular process
GO:0048518	0.579	positive regulation of biological process
GO:0048522	0.532	positive regulation of cellular process
GO:0009893	0.453	positive regulation of metabolic process
GO:0031325	0.434	positive regulation of cellular metabolic process
GO:0010604	0.432	positive regulation of macromolecule metabolic process
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0009891	0.413	positive regulation of biosynthetic process
GO:0010557	0.403	positive regulation of macromolecule biosynthetic process
GO:0045935	0.379	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.372	positive regulation of cellular biosynthetic process
GO:0051254	0.371	positive regulation of RNA metabolic process
GO:1902680	0.353	positive regulation of RNA biosynthetic process
GO:0045893	0.338	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005829	0.978	cytosol
GO:0043232	0.706	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]