StarFunc result for job id Q5HYM0

User Input

>input (836 residues)
MTATAEVETPKMEKSASKEEKQQPKQDSTEQGNADSEEWMSSESDPEQISLKSSDNSKSC
QPRDGQLKKKEMHSKPHRQLCRSPCLDRPSFSQSSILQDGKLDLEKEYQAKMEFALKLGY
AEEQIQSVLNKLGPESLINDVLAELVRLGNKGDSEGQINLSLLVPRGPSSREIASPELSL
EDEIDNSDNLRPVVIDGSNVAMSHGNKEEFSCRGIQLAVDWFLDKGHKDITVFVPAWRKE
QSRPDAPITDQDILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFDSDGIIVSNDN
YRDLQVEKPEWKKFIEERLLMYSFVNDKFMPPDDPLGRHGPSLENFLRKRPIVPEHKKQP
CPYGKKCTYGHKCKYYHPERANQPQRSVADELRISAKLSTVKTMSEGTLAKCGTGMSSAK
GEITSEVKRVAPKRQSDPSIRSVAMEPEEWLSIARKPEASSVPSLVTALSVPTIPPPKSH
AVGALNTRSASSPVPGSSHFPHQKASLEHMASMQYPPILVTNSHGTPISYAEQYPKFESM
GDHGYYSMLGDFSKLNINSMHNREYYMAEVDRGVYARNPNLCSDSRVSHTRNDNYSSYNN
VYLAVADTHPEGNLKLHRSASQNRLQPFPHGYHEALTRVQSYGPEDSKQGPHKQSVPHLA
LHAQHPSTGTRSSCPADYPMPPNIHPGATPQPGRALVMTRMDSISDSRLYESNPVRQRRP
PLCREQHASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVRSVPEKMEQLWRNPWVGMC
NDSREHMIPEHQYQTYKNLCNIFPSNIVLAVMEKNPHTADAQQLAALIVAKLRAAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0D7	0.256	0.244	6.610E-76	883	0.530	0.502	Q9C0D7.pdb.gz	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
2	PDB:5dizA	0.137	0.236	2.017E-4	474	0.029	0.051	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.
3	PDB:7onuE	0.138	0.237	7.274E-4	467	0.032	0.058	7onuE.pdb.gz	Structural basis of RNA processing by human mitochondrial RNase P.
4	AFDB:Q2EI20	0.062	0.061	1.499E-3	855	0.106	0.104	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
5	AFDB:Q8IK49	0.055	0.043	3.982E-3	1263	0.134	0.089	Q8IK49.pdb.gz	Q8IK49_PLAF7 EMP1-trafficking protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1478600 PE=4 SV=1
6	AFDB:M9PF57	0.048	0.035	4.233E-3	1385	0.176	0.106	M9PF57.pdb.gz	M9PF57_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=CG8154 PE=1 SV=1
7	AFDB:A0A0K3AXH1	0.053	0.035	4.783E-3	1648	0.144	0.073	A0A0K3AXH1.pdb.gz	ARID1_CAEEL AT-rich interactive domain-containing protein arid-1 OS=Caenorhabditis elegans OX=6239 GN=arid-1 PE=3 SV=1
8	AFDB:Q8VIB2	0.058	0.064	1.436E-2	731	0.128	0.146	Q8VIB2.pdb.gz	DAXX_RAT Death domain-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Daxx PE=1 SV=1
9	AFDB:Q9V4D8	0.068	0.041	2.071E-2	1738	0.134	0.064	Q9V4D8.pdb.gz	Q9V4D8_DROME FI14922p OS=Drosophila melanogaster OX=7227 GN=Tdg PE=1 SV=1
10	AFDB:A0A1D8PD52	0.041	0.030	3.176E-2	1287	0.142	0.092	A0A1D8PD52.pdb.gz	A0A1D8PD52_CANAL Msb1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB1 PE=4 SV=1
11	PDB:3ivtB	0.077	0.124	3.208E-2	400	0.026	0.055	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
12	PDB:7d5s5K	0.112	0.395	3.853E-2	175	0.032	0.154	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:7mq8SL	0.099	0.308	3.853E-2	192	0.033	0.146	7mq8SL.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	AFDB:Q9NEL2	0.051	0.028	4.055E-2	2395	0.120	0.042	Q9NEL2.pdb.gz	SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4
15	AFDB:P54786	0.060	0.057	4.870E-2	942	0.122	0.108	P54786.pdb.gz	ZDS2_YEAST Protein ZDS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZDS2 PE=1 SV=1
16	PDB:5hnkA	0.099	0.240	5.229E-2	272	0.033	0.103	5hnkA.pdb.gz	Direct observation of DNA threading in flap endonuclease complexes.
17	PDB:7dskA	0.089	0.129	8.523E-2	471	0.031	0.055	7dskA.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
18	PDB:2q46A	0.076	0.168	1.229E-1	253	0.031	0.103	2q46A.pdb.gz	Ensemble refinement of protein crystal structures: validation and application.
19	PDB:4gslA	0.100	0.132	2.004E-1	598	0.024	0.033	4gslA.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
20	PDB:4gskB	0.094	0.126	2.559E-1	572	0.028	0.040	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0D7	0.0	809	883	0.538	0.510	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
2	Q5D1E7	2.32e-140	430	596	0.248	0.347	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
3	Q5D1E8	1.16e-135	418	599	0.243	0.339	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
4	A2A288	3.04e-119	373	527	0.214	0.340	ZC12D_HUMAN Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3
5	Q8BIY3	4.80e-117	367	533	0.212	0.332	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
6	Q6A037	8.63e-49	188	893	0.108	0.101	N4BP1_MOUSE NEDD4-binding protein 1 OS=Mus musculus OX=10090 GN=N4bp1 PE=1 SV=2
7	O15037	1.01e-47	182	678	0.106	0.131	KHNYN_HUMAN Protein KHNYN OS=Homo sapiens OX=9606 GN=KHNYN PE=1 SV=3
8	O75113	3.05e-47	184	896	0.105	0.098	N4BP1_HUMAN NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4
9	B7ZBA4	1.80e-39	145	167	0.094	0.473	B7ZBA4_HUMAN Zinc finger CCCH-type containing 12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1
10	Q5BDV3	0.13	38.1	504	0.033	0.056	ABFC_EMENI Alpha-L-arabinofuranosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=abfC PE=2 SV=1
11	G5EFL5	1.0	35.4	1424	0.029	0.017	G5EFL5_CAEEL PDZ and LIM domain protein Zasp OS=Caenorhabditis elegans OX=6239 GN=alp-1 PE=1 SV=1
12	A8MYR2	2.3	33.5	226	0.038	0.142	A8MYR2_HUMAN L-methionine (R)-S-oxide reductase OS=Homo sapiens OX=9606 GN=MSRB1 PE=1 SV=1
13	Q6NPN3	2.3	34.3	465	0.024	0.043	C3H58_ARATH Zinc finger CCCH domain-containing protein 58 OS=Arabidopsis thaliana OX=3702 GN=At5g18550 PE=2 SV=1
14	F4IUS5	3.3	33.5	457	0.035	0.063	F4IUS5_ARATH Zinc finger nuclease 2 OS=Arabidopsis thaliana OX=3702 GN=ZFN2 PE=1 SV=2
15	Q93WV0	4.7	33.1	557	0.026	0.039	WRK20_ARATH Probable WRKY transcription factor 20 OS=Arabidopsis thaliana OX=3702 GN=WRKY20 PE=2 SV=1
16	Q9HT32	5.2	32.7	414	0.016	0.031	Q9HT32_PSEAE Beta-lactamase-related domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5542 PE=4 SV=1
17	A0A0G2K3N6	6.6	32.7	1544	0.018	0.010	A0A0G2K3N6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
18	A0A0G2K6G9	6.7	32.7	1517	0.018	0.010	A0A0G2K6G9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
19	Q80Y84	6.7	32.7	1544	0.018	0.010	KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus OX=10090 GN=Kdm5b PE=1 SV=1
20	Q9QXP6	7.1	32.7	481	0.025	0.044	MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus OX=10090 GN=Mkrn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18561 Regnase_1_C	1e-10	52.5	Endoribonuclease Regnase 1/ ZC3H12 C-terminal domain
2	PF11977 RNase_Zc3h12a	3.4e-62	220.2	Zc3h12a-like Ribonuclease NYN domain
3	PF18039 UBA_6	2e-15	67.8	UBA-like domain
4	PF14608 zf-CCCH_2	36	16.4	RNA-binding, Nab2-type zinc finger
5	PF18044 zf-CCCH_4	98	14.2	CCCH-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363985	0.641	Myotubularin-related protein 8
2	9606.ENSP00000221086	0.638	Myotubularin-related protein 9
3	9606.ENSP00000355195	0.582	Ankyrin repeat and SOCS box protein 12
4	9606.ENSP00000362774	0.568	Roquin-2
5	9606.ENSP00000483408	0.549	RNA-binding protein 26
6	9606.ENSP00000253048	0.531	Zinc finger CCCH domain-containing protein 4
7	9606.ENSP00000275766	0.528	Zinc finger CCCH-type containing, antiviral 1 like
8	9606.ENSP00000338788	0.528	Zinc finger CCCH domain-containing protein 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.940	RNA binding
GO:0003824	0.930	catalytic activity
GO:0016787	0.880	hydrolase activity
GO:0016788	0.728	hydrolase activity, acting on ester bonds
GO:0003729	0.558	mRNA binding
GO:0004518	0.354	nuclease activity
GO:0004540	0.331	ribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0048523	0.986	negative regulation of cellular process
GO:0009987	0.981	cellular process
GO:0080090	0.977	regulation of primary metabolic process
GO:0010468	0.976	regulation of gene expression
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031329	0.969	regulation of cellular catabolic process
GO:0010605	0.959	negative regulation of macromolecule metabolic process
GO:0048518	0.958	positive regulation of biological process
GO:0009893	0.953	positive regulation of metabolic process
GO:0048522	0.944	positive regulation of cellular process
GO:0043170	0.942	macromolecule metabolic process
GO:0010629	0.940	negative regulation of gene expression
GO:0050896	0.924	response to stimulus
GO:0051716	0.912	cellular response to stimulus
GO:0031324	0.893	negative regulation of cellular metabolic process
GO:0044237	0.854	cellular metabolic process
GO:0051239	0.804	regulation of multicellular organismal process
GO:0048583	0.797	regulation of response to stimulus
GO:0019219	0.781	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.774	regulation of protein metabolic process
GO:0031326	0.762	regulation of cellular biosynthetic process
GO:0031325	0.751	positive regulation of cellular metabolic process
GO:0006807	0.750	nitrogen compound metabolic process
GO:0051252	0.747	regulation of RNA metabolic process
GO:0010556	0.745	regulation of macromolecule biosynthetic process
GO:0010604	0.732	positive regulation of macromolecule metabolic process
GO:0065008	0.668	regulation of biological quality
GO:0090304	0.659	nucleic acid metabolic process
GO:0061013	0.656	regulation of mRNA catabolic process
GO:0043488	0.650	regulation of mRNA stability
GO:0031331	0.649	positive regulation of cellular catabolic process
GO:0006417	0.646	regulation of translation
GO:0051172	0.642	negative regulation of nitrogen compound metabolic process
GO:0017148	0.628	negative regulation of translation
GO:1901361	0.613	organic cyclic compound catabolic process
GO:0019439	0.610	aromatic compound catabolic process
GO:0044265	0.609	cellular macromolecule catabolic process
GO:0046700	0.608	heterocycle catabolic process
GO:0034655	0.597	nucleobase-containing compound catabolic process
GO:0016070	0.596	RNA metabolic process
GO:1903313	0.565	positive regulation of mRNA metabolic process
GO:0061014	0.558	positive regulation of mRNA catabolic process
GO:0002694	0.555	regulation of leukocyte activation
GO:0051241	0.531	negative regulation of multicellular organismal process
GO:0061157	0.518	mRNA destabilization
GO:0006401	0.496	RNA catabolic process
GO:0031399	0.487	regulation of protein modification process
GO:0002376	0.478	immune system process
GO:0001817	0.475	regulation of cytokine production
GO:0002683	0.458	negative regulation of immune system process
GO:0050866	0.437	negative regulation of cell activation
GO:0002695	0.411	negative regulation of leukocyte activation
GO:0001818	0.335	negative regulation of cytokine production
GO:0050793	0.334	regulation of developmental process
GO:1902531	0.308	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.980	nucleus
GO:0005829	0.967	cytosol
GO:0016020	0.963	membrane
GO:0043232	0.885	intracellular non-membrane-bounded organelle
GO:0031981	0.799	nuclear lumen
GO:0005654	0.763	nucleoplasm
GO:0012505	0.660	endomembrane system
GO:0032991	0.352	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.880	Hydrolases.
EC:3.1.-.-	0.728	Acting on ester bonds.

[back to server]