StarFunc result for job id Q5HYW2

User Input

>input (1225 residues)
MPFYRRTVVPQRLCPRNPPQQLAELRDVSHLAALSLLRQLADLCGHSLALLEDLEGHLLA
LGRRTDSLYRRTVRLRRRLPCRLLGPEEDEEELAAANSGRENATATAHSRSSWRQPVNVF
LSSGRPPSVEELLREAQLNLQSLLQEEYEEQYSEARLVGQTFRSSDEATKPTPNPRPQSA
RRLEFILMPTKRQLSEDETTTQGVRAPEASLSLSTTADKQTAWNSLFPLPILEEKRWPQL
CSTQSDIVPINISGQQFDKHASLRHSLFNTETAVNPKSTLRRRRTIIGFSNFSQRDQGHS
NSPAGSVAHSTTSDIRPSHSVPEGVHGRVAVGQDARFPSLTSPVLRTPSSEPDEPHQARS
GPNPPGMESMGMVYSVPSSCNGPTESTFSTSWKGDAFTYMTPSATSQSNQVNENGKNPSC
GNSWVSLNKVPPLVPKEAATLLVARDNPAGCSGSAGYPERLIQQRHMPERPSKIGLLTSG
TSRLETGPGGASRFRERSLSVPTDSGTTDVDYDEEQKANEACALPFASTSSEGSNSADNI
ASLSAQQEAQHRRQRSKSISLRKAKKKPSPPTRSVSLVKDEPGLLPEGGSALPKDQRPKS
LCLSLEHQGHHSSHPDAQGHPAIPNHKDPESTQFSHHWYLTDWKSGDTYQSLSSSSTATG
TTVIECTQVQGSSESLASPSTSRATTPSQLSIEVEAREISSPGRPPGLMSPSSGYSSQSE
TPTPTVSMSLTLGHLPPPSSSVRVRPVVPERKSSLPPTSPMEKFPKSRLSFDLPLTSSPN
LDLSGMSISIRSKTKVSRHHSETNFGVKLAQKTNPNQPIMPMVTQSDLRSVRLRSVSKSE
PEDDIESPEYAEEPRAEEVFTLPERKTKPPVAEKPPVARRPPSLVHKPPSVPEEYALTSP
TLAMPPRSSIQHARPLPQDSYTVVRKPKPSSFPDGRSPGESTAPSSLVFTPFASSSDAFF
SGTQQPPQGSVEDEGPKVRVLPERISLQSQEEAEKKKGKIPPPVPKKPSVLYLPLTSPTA
QMEAYVAEPRLPLSPIITLEEDTKCPATGDDLQSLGQRVTSTPQADSEREASPLGSSVEP
GTEEKSLISDKTAEWIAEDDDDVFVASRTTEDLFTVIHRSKRKLLGWKEPGEAFVGGRTS
SHSPIKNTAESPISESTATAGSGSSANLDAGRNDDFKALLQKKGSKATPRSRPSAAELLK
TTNPLARRIIAQFSKDYETTDNPST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5HYW2	1.000	1.000	0.000	1225	1.000	1.000	Q5HYW2.pdb.gz	NHSL2_HUMAN NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=2
2	AFDB:B1AV60	0.065	0.052	5.300E-23	1647	0.283	0.211	B1AV60.pdb.gz	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
3	AFDB:Q6T4R5	0.067	0.053	3.119E-20	1651	0.284	0.211	Q6T4R5.pdb.gz	NHS_HUMAN Actin remodeling regulator NHS OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2
4	AFDB:E7EXR7	0.094	0.074	3.527E-14	1606	0.273	0.208	E7EXR7.pdb.gz	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
5	AFDB:Q9LP46	0.084	0.099	1.802E-4	1020	0.149	0.179	Q9LP46.pdb.gz	SCAR3_ARATH Protein SCAR3 OS=Arabidopsis thaliana OX=3702 GN=SCAR3 PE=1 SV=1
6	AFDB:Q4AB30	0.084	0.097	1.800E-3	1044	0.121	0.142	Q4AB30.pdb.gz	Q4AB30_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=1
7	AFDB:Q6PGL7	0.054	0.050	3.704E-2	1334	0.157	0.144	Q6PGL7.pdb.gz	WASC2_MOUSE WASH complex subunit 2 OS=Mus musculus OX=10090 GN=Washc2 PE=1 SV=1
8	AFDB:Q6XZL8	0.044	0.036	3.956E-2	1540	0.179	0.142	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
9	AFDB:Q8IZL2	0.049	0.051	4.819E-2	1156	0.126	0.133	Q8IZL2.pdb.gz	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
10	AFDB:Q5YL88	0.040	0.041	5.869E-2	1205	0.156	0.159	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
11	PDB:4n78D	0.082	0.448	7.626E-1	202	0.023	0.139	4n78D.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:4v6wCC	0.047	0.106	2.841	392	0.010	0.031	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:6qlfQ	0.044	0.208	5.133	204	0.016	0.098	6qlfQ.pdb.gz
14	PDB:7kzfF	0.031	0.063	5.482	483	0.017	0.043	7kzfF.pdb.gz
15	PDB:1i7fA	0.023	0.087	8.686	228	0.010	0.053	1i7fA.pdb.gz
16	PDB:7r5jW0	0.042	0.066	9.276	735	0.020	0.033	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HYW2	0.0	2472	1225	1.000	1.000	NHSL2_HUMAN NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=2
2	B2RXX7	3.88e-22	106	1647	0.124	0.092	B2RXX7_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
3	B1AV60	4.33e-22	106	1647	0.124	0.092	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
4	B7ZWM3	4.79e-22	106	1647	0.124	0.092	B7ZWM3_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
5	Q6T4R5	4.88e-22	106	1651	0.121	0.090	NHS_HUMAN Actin remodeling regulator NHS OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2
6	B9EJX2	5.02e-22	105	1626	0.124	0.093	B9EJX2_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
7	A0A087WU78	5.75e-22	105	1447	0.121	0.102	A0A087WU78_HUMAN NHS actin remodeling regulator OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=1
8	E7EXR7	3.06e-18	93.6	1606	0.075	0.057	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
9	Q9Y6W5	0.003	43.9	498	0.023	0.056	WASF2_HUMAN Actin-binding protein WASF2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3
10	Q8BH43	0.015	42.0	497	0.021	0.052	WASF2_MOUSE Actin-binding protein WASF2 OS=Mus musculus OX=10090 GN=Wasf2 PE=1 SV=1
11	Q9VE16	0.84	36.2	534	0.027	0.062	Q9VE16_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=2 SV=2
12	Q9UMN6	1.9	35.4	2715	0.021	0.010	KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1
13	O08550	2.8	34.7	2713	0.021	0.010	KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus OX=10090 GN=Kmt2b PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15273 NHS	1.4e-22	92.2	NHS-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005593994.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005572085.1	0.623	Uncharacterized protein
2	9541.XP_005592215.1	0.590	CKLF-like MARVEL transmembrane domain-containing protein 4
3	9541.XP_005555753.1	0.584	AP-1 complex-associated regulatory protein isoform X1
4	9541.XP_005559701.1	0.561	DNA-directed RNA polymerase II subunit GRINL1A isoform X1
5	9541.XP_005563541.1	0.550	Brefeldin A-inhibited guanine nucleotide-exchange protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048731	0.965	system development
GO:0030154	0.921	cell differentiation
GO:0007399	0.644	nervous system development
GO:0065007	0.595	biological regulation
GO:0050789	0.583	regulation of biological process
GO:0050794	0.486	regulation of cellular process
GO:0071840	0.401	cellular component organization or biogenesis
GO:0016043	0.354	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005737	0.959	cytoplasm
GO:0043226	0.935	organelle
GO:0043229	0.924	intracellular organelle
GO:0043227	0.759	membrane-bounded organelle
GO:0043231	0.743	intracellular membrane-bounded organelle
GO:0016020	0.681	membrane
GO:0012505	0.624	endomembrane system
GO:0005634	0.493	nucleus
GO:0043233	0.415	organelle lumen
GO:0070013	0.410	intracellular organelle lumen
GO:0005654	0.398	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]