StarFunc result for job id Q5I7T1

User Input

>input (473 residues)
MAQLEGYCFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDP
MITTLPGLYLVSVGVVKPAIWIFAWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFHKVQP
RNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGF
CGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAY
SMSFKNLSMLFCLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLF
FSFPHLLSPSKIKTFLSLVWKHGILFLVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWK
RVFQRYAILKYLLVPAYIFAGWSIADSLKSKPIFWNLMFFICLFIVIVPQKLLEFRYFIL
PYVIYRLNITLPPTSRLVCELSCYAIVNFITFYIFLNKTFQWPNSQDIQRFMW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5BKT4	0.998	0.998	1.393E-61	473	0.960	0.960	Q5BKT4.pdb.gz	AG10A_HUMAN Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG10 PE=1 SV=1
2	AFDB:O88788	0.996	0.993	6.236E-58	474	0.860	0.859	O88788.pdb.gz	AG10B_RAT Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Alg10b PE=1 SV=1
3	AFDB:Q8L638	0.887	0.827	5.940E-30	509	0.317	0.295	Q8L638.pdb.gz	ALG10_ARATH Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG10 PE=1 SV=1
4	AFDB:Q10254	0.838	0.888	2.814E-25	445	0.338	0.360	Q10254.pdb.gz	ALG10_SCHPO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg10 PE=3 SV=1
5	AFDB:P50076	0.812	0.736	3.059E-22	525	0.288	0.259	P50076.pdb.gz	ALG10_YEAST Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIE2 PE=1 SV=2
6	AFDB:Q9NUD9	0.366	0.354	4.776E-5	493	0.152	0.146	Q9NUD9.pdb.gz	PIGV_HUMAN GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
7	AFDB:F1PJP5	0.444	0.318	1.884E-4	705	0.169	0.113	F1PJP5.pdb.gz	STT3A_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
8	AFDB:Q09712	0.362	0.369	3.291E-4	464	0.161	0.164	Q09712.pdb.gz	GPI18_SCHPO GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
9	AFDB:Q7KN63	0.393	0.254	4.257E-4	797	0.146	0.087	Q7KN63.pdb.gz	Q7KN63_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=2 SV=1
10	AFDB:Q9VRE0	0.418	0.293	7.760E-4	713	0.144	0.095	Q9VRE0.pdb.gz	Q9VRE0_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3A PE=1 SV=1
11	PDB:6s7tA	0.427	0.309	3.504E-3	706	0.156	0.105	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
12	PDB:5oglA	0.322	0.233	5.155E-3	707	0.116	0.078	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
13	PDB:6s7oA	0.346	0.260	6.668E-3	656	0.148	0.107	6s7oA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
14	PDB:7w72U	0.308	0.340	1.024E-2	420	0.125	0.140	7w72U.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
15	PDB:6eznF	0.333	0.252	3.707E-2	650	0.123	0.089	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
16	PDB:6p25A	0.311	0.213	5.454E-2	731	0.074	0.048	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
17	PDB:6p25B	0.295	0.210	6.759E-2	690	0.066	0.045	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
18	PDB:6snhX	0.321	0.318	2.783E-1	479	0.131	0.129	6snhX.pdb.gz	Structure and mechanism of the ER-based glucosyltransferase ALG6.
19	PDB:3zhpA	0.115	0.149	5.771E-1	315	0.051	0.076	3zhpA.pdb.gz
20	PDB:7ccsB	0.135	0.138	8.862E-1	454	0.142	0.148	7ccsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88788	0.0	794	474	0.860	0.859	AG10B_RAT Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Alg10b PE=1 SV=1
2	Q3UGP8	0.0	789	474	0.852	0.850	AG10B_MOUSE Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg10b PE=1 SV=1
3	Q5BKT4	0.0	896	473	0.960	0.960	AG10A_HUMAN Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG10 PE=1 SV=1
4	Q5I7T1	0.0	961	473	1.000	1.000	AG10B_HUMAN Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG10B PE=1 SV=2
5	Q8L638	1.11e-67	227	509	0.332	0.308	ALG10_ARATH Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG10 PE=1 SV=1
6	Q10254	6.64e-61	207	445	0.359	0.382	ALG10_SCHPO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg10 PE=3 SV=1
7	P50076	3.38e-36	142	525	0.298	0.269	ALG10_YEAST Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIE2 PE=1 SV=2
8	P59551	1.7	33.5	318	0.061	0.091	T2R60_HUMAN Taste receptor type 2 member 60 OS=Homo sapiens OX=9606 GN=TAS2R60 PE=2 SV=1
9	Q8IDZ6	2.7	33.1	1838	0.063	0.016	Q8IDZ6_PLAF7 Ubiquitin-activating enzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1333200 PE=3 SV=1
10	O45352	7.8	31.2	254	0.051	0.094	O45352_CAEEL Glutathione S-transferase omega OS=Caenorhabditis elegans OX=6239 GN=gst-44 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04922 DIE2_ALG10	1.4e-125	431.3	DIE2/ALG10 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299626	0.988	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
2	9606.ENSP00000360149	0.917	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
3	9606.ENSP00000376472	0.907	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
4	9606.ENSP00000295770	0.901	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
5	9606.ENSP00000333813	0.880	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
6	9606.ENSP00000380793	0.869	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
7	9606.ENSP00000262186	0.861	Potassium voltage-gated channel subfamily H member 2
8	9606.ENSP00000239891	0.860	ALG5, dolichyl-phosphate beta-glucosyltransferase
9	9606.ENSP00000482396	0.852	Alpha-1,2-mannosyltransferase ALG9
10	9606.ENSP00000482437	0.852	Mannosyltransferase
11	9606.ENSP00000424544	0.851	Tumor suppressor candidate 3
12	9606.ENSP00000399457	0.848	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
13	9606.ENSP00000296255	0.845	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
14	9606.ENSP00000237530	0.833	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
15	9606.ENSP00000266483	0.800	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
16	9606.ENSP00000233616	0.783	Mannosyl-oligosaccharide glucosidase
17	9606.ENSP00000430236	0.765	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
18	9606.ENSP00000378260	0.746	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
19	9606.ENSP00000250498	0.742	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
20	9606.ENSP00000386597	0.693	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.770	catalytic activity
GO:0016740	0.734	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.867	organic substance metabolic process
GO:0044237	0.864	cellular metabolic process
GO:0044238	0.863	primary metabolic process
GO:0006807	0.856	nitrogen compound metabolic process
GO:1901564	0.827	organonitrogen compound metabolic process
GO:0043170	0.796	macromolecule metabolic process
GO:0044260	0.786	cellular macromolecule metabolic process
GO:0036211	0.785	protein modification process
GO:1901135	0.691	carbohydrate derivative metabolic process
GO:0034645	0.685	cellular macromolecule biosynthetic process
GO:1901566	0.681	organonitrogen compound biosynthetic process
GO:1901137	0.678	carbohydrate derivative biosynthetic process
GO:0006486	0.672	protein glycosylation
GO:0006487	0.463	protein N-linked glycosylation
GO:0065007	0.460	biological regulation
GO:0050789	0.365	regulation of biological process
GO:0006810	0.301	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0042175	0.906	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.902	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.734	Transferases.

[back to server]