StarFunc result for job id Q5IJ48

User Input

>input (1285 residues)
MALARPGTPDPQALASVLLLLLWAPALSLLAGTVPSEPPSACASDPCAPGTECQATESGG
YTCGPMEPRGCATQPCHHGALCVPQGPDPTGFRCYCVPGFQGPRCELDIDECASRPCHHG
ATCRNLADRYECHCPLGYAGVTCEMEVDECASAPCLHGGSCLDGVGSFRCVCAPGYGGTR
CQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGTHCEREVLECASAPCEHNASCLE
GLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDPALYGGVQAAFPGAFSFRH
AAGFLCHCPPGFEGADCGVEVDECASRPCLNGGHCQDLPNGFQCHCPDGYAGPTCEEDVD
ECLSDPCLHGGTCSDTVAGYICRCPETWGGRDCSVQLTGCQGHTCPLAATCIPIFESGVH
SYVCHCPPGTHGPFCGQNTTFSVMAGSPIQASVPAGGPLGLALRFRTTLPAGTLATRNDT
KESLELALVAATLQATLWSYSTTVLVLRLPDLALNDGHWHQVEVVLHLATLELRLWHEGC
PARLCVASGPVALASTASATPLPAGISSAQLGDATFAGCLQDVRVDGHLLLPEDLGENVL
LGCERREQCRPLPCVHGGSCVDLWTHFRCDCARPHRGPTCADEIPAATFGLGGAPSSASF
LLQELPGPNLTVSFLLRTRESAGLLLQFANDSAAGLTVFLSEGRIRAEVPGSPAVVLPGR
WDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFF
PLPLDNSSQPSELGGRQSWNLTAGCVSEDMCSPDPCFNGGTCLVTWNDFHCTCPANFTGP
TCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFREGPPAAFSGHNASSGRLLGGLSLAF
RTRDSEAWLLRAAAGALEGVWLAVRNGSLAGGVRGGHGLPGAVLPIPGPRVADGAWHRVR
LAMERPAATTSRWLLWLDGAATPVALRGLASDLGFLQGPGAVRILLAENFTGCLGRVALG
GLPLPLARPRPGAAPGAREHFASWPGTPAPILGCRGAPVCAPSPCLHDGACRDLFDAFAC
ACGPGWEGPRCEAHVDPCHSAPCARGRCHTHPDGRFECRCPPGFGGPRCRLPVPSKECSL
NVTCLDGSPCEGGSPAANCSCLEGLAGQRCQVPTLPCEANPCLNGGTCRAAGGVSECICN
ARFSGQFCEVAKGLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSP
SQQEVAGARLEMDSVLKVPPEERLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZL8	0.396	0.368	0.000	1407	0.347	0.317	D3ZZL8.pdb.gz	D3ZZL8_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=2
2	AFDB:P82279	0.354	0.327	0.000	1406	0.335	0.307	P82279.pdb.gz	CRUM1_HUMAN Protein crumbs homolog 1 OS=Homo sapiens OX=9606 GN=CRB1 PE=1 SV=2
3	AFDB:Q1A5L2	0.477	0.422	0.000	1466	0.407	0.357	Q1A5L2.pdb.gz	Q1A5L2_DANRE Crb2 OS=Danio rerio OX=7955 GN=crb2 PE=1 SV=1
4	AFDB:Q1L927	0.354	0.326	0.000	1428	0.346	0.312	Q1L927.pdb.gz
5	AFDB:Q5IJ48	1.000	1.000	0.000	1285	1.000	1.000	Q5IJ48.pdb.gz	CRUM2_HUMAN Protein crumbs homolog 2 OS=Homo sapiens OX=9606 GN=CRB2 PE=1 SV=2
6	AFDB:Q80YA8	0.548	0.549	0.000	1282	0.783	0.785	Q80YA8.pdb.gz	CRUM2_MOUSE Protein crumbs homolog 2 OS=Mus musculus OX=10090 GN=Crb2 PE=1 SV=3
7	AFDB:Q8VHS2	0.324	0.301	0.000	1405	0.338	0.309	Q8VHS2.pdb.gz	CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus OX=10090 GN=Crb1 PE=1 SV=3
8	AFDB:P10040	0.444	0.281	6.017E-83	2146	0.335	0.200	P10040.pdb.gz	CRB_DROME Protein crumbs OS=Drosophila melanogaster OX=7227 GN=crb PE=1 SV=3
9	AFDB:Q19350	0.298	0.230	8.267E-73	1722	0.244	0.182	Q19350.pdb.gz	Q19350_CAEEL Drosophila CRumBs homolog OS=Caenorhabditis elegans OX=6239 GN=crb-1 PE=4 SV=1
10	AFDB:P46531	0.092	0.051	5.731E-53	2555	0.243	0.122	P46531.pdb.gz	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
11	PDB:7q3nU	0.059	0.181	1.168E-4	292	0.033	0.147	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:6m5yA	0.074	0.302	5.250E-4	270	0.028	0.133	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
13	PDB:2a3wA	0.102	0.542	7.838E-4	204	0.025	0.157	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
14	PDB:4pbpB	0.091	0.497	2.030E-3	210	0.016	0.095	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
15	PDB:7tzcA	0.075	0.026	2.030E-3	4404	0.071	0.021	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
16	PDB:5jowA	0.076	0.165	2.481E-3	504	0.049	0.125	5jowA.pdb.gz
17	PDB:1umzA	0.083	0.306	3.187E-3	267	0.015	0.071	1umzA.pdb.gz	Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding
18	PDB:3v0aB	0.084	0.093	3.187E-3	1150	0.019	0.021	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:6vlsD	0.058	0.066	3.187E-3	963	0.044	0.059	6vlsD.pdb.gz
20	PDB:5jozA	0.073	0.161	3.894E-3	507	0.053	0.134	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZKN7	0.0	704	1336	0.327	0.314	A0A8I5ZKN7_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=1
2	A0A8I6A4M0	0.0	644	1314	0.317	0.310	A0A8I6A4M0_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=1
3	D3ZZL8	0.0	729	1407	0.349	0.318	D3ZZL8_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=2
4	P82279	0.0	651	1406	0.336	0.307	CRUM1_HUMAN Protein crumbs homolog 1 OS=Homo sapiens OX=9606 GN=CRB1 PE=1 SV=2
5	Q1A5L1	0.0	868	1458	0.406	0.358	Q1A5L1_DANRE Crumbs cell polarity complex component 2b precursor OS=Danio rerio OX=7955 GN=crb2l PE=2 SV=1
6	Q1A5L2	0.0	904	1466	0.416	0.364	Q1A5L2_DANRE Crb2 OS=Danio rerio OX=7955 GN=crb2 PE=1 SV=1
7	Q1A5L3	0.0	678	1428	0.362	0.326	Q1A5L3_DANRE Crumbs-like protein 1 OS=Danio rerio OX=7955 GN=si:dkey-114d20.6 PE=2 SV=1
8	Q5IJ48	0.0	2534	1285	1.000	1.000	CRUM2_HUMAN Protein crumbs homolog 2 OS=Homo sapiens OX=9606 GN=CRB2 PE=1 SV=2
9	Q80YA8	0.0	1897	1282	0.777	0.778	CRUM2_MOUSE Protein crumbs homolog 2 OS=Mus musculus OX=10090 GN=Crb2 PE=1 SV=3
10	Q8VHS2	0.0	700	1405	0.346	0.317	CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus OX=10090 GN=Crb1 PE=1 SV=3
11	P10040	5.69e-168	553	2146	0.319	0.191	CRB_DROME Protein crumbs OS=Drosophila melanogaster OX=7227 GN=crb PE=1 SV=3
12	A0A8I6AQJ2	2.52e-121	396	760	0.173	0.292	A0A8I6AQJ2_RAT Crumbs cell polarity complex component 1 OS=Rattus norvegicus OX=10116 GN=Crb1 PE=4 SV=1
13	Q19350	2.11e-91	328	1722	0.264	0.197	Q19350_CAEEL Drosophila CRumBs homolog OS=Caenorhabditis elegans OX=6239 GN=crb-1 PE=4 SV=1
14	A2RUV0	1.47e-83	304	2522	0.133	0.068	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
15	P46531	1.43e-82	301	2555	0.135	0.068	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
16	Q01705	2.46e-81	297	2531	0.135	0.069	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
17	P21783	3.23e-81	297	2524	0.128	0.065	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
18	G3I6Z6	5.16e-80	293	2527	0.135	0.068	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
19	Q07008	9.27e-80	292	2531	0.135	0.068	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
20	A0PGH6	1.02e-79	292	2465	0.132	0.069	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	3.4e-73	252.8	EGF-like domain
2	PF07974 EGF_2	0.048	25.3	EGF-like domain
3	PF12947 EGF_3	0.61	21.6	EGF domain
4	PF07645 EGF_CA	1.3e-09	49.4	Calcium-binding EGF domain
5	PF12661 hEGF	1.1e-37	138.6	Human growth factor-like EGF
6	PF00054 Laminin_G_1	1.1e-07	43.6	Laminin G domain
7	PF02210 Laminin_G_2	7.2e-20	83.3	Laminin G domain
8	PF13385 Laminin_G_3	2.4e+02	13.2	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362734

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261681	0.941	MAGUK p55 subfamily member 5
2	9606.ENSP00000244537	0.845	Histone cluster 1 H4 family member f
3	9606.ENSP00000356370	0.823	Protein crumbs homolog 1
4	9606.ENSP00000263713	0.816	Band 4.1-like protein 5
5	9606.ENSP00000360200	0.803	InaD-like protein
6	9606.ENSP00000345206	0.744	Recombining binding protein suppressor of hairless
7	9606.ENSP00000349204	0.740	Protein crumbs homolog 3
8	9606.ENSP00000371475	0.686	TP53-binding protein 1
9	9606.ENSP00000363921	0.685	Partitioning defective 3 homolog
10	9606.ENSP00000362717	0.672	LIM/homeobox protein Lhx2
11	9606.ENSP00000356355	0.663	Serine/threonine-protein kinase Nek7
12	9606.ENSP00000362702	0.662	Serine/threonine-protein kinase Nek6
13	9606.ENSP00000439807	0.647	Multiple PDZ domain protein
14	9606.ENSP00000337443	0.645	Nucleoredoxin
15	9606.ENSP00000295797	0.643	Protein kinase C iota type
16	9606.ENSP00000362727	0.641	DENN domain-containing protein 1A
17	9606.ENSP00000317790	0.622	Spectrin beta, non-erythrocytic 5
18	9606.ENSP00000356357	0.618	LIM/homeobox protein Lhx9
19	9606.ENSP00000229340	0.588	Ras-related protein Rab-35
20	9606.ENSP00000361027	0.583	Angiomotin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.749	protein-containing complex binding
GO:0098772	0.746	molecular function regulator activity
GO:0061134	0.727	peptidase regulator activity
GO:0140678	0.724	molecular function inhibitor activity
GO:0061135	0.717	endopeptidase regulator activity
GO:0030414	0.697	peptidase inhibitor activity
GO:0004866	0.694	endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0009987	0.989	cellular process
GO:0048856	0.981	anatomical structure development
GO:0050794	0.976	regulation of cellular process
GO:0032501	0.878	multicellular organismal process
GO:0019222	0.769	regulation of metabolic process
GO:0060255	0.739	regulation of macromolecule metabolic process
GO:0007275	0.734	multicellular organism development
GO:0048519	0.716	negative regulation of biological process
GO:0080090	0.706	regulation of primary metabolic process
GO:0051171	0.706	regulation of nitrogen compound metabolic process
GO:0010605	0.676	negative regulation of macromolecule metabolic process
GO:0051172	0.672	negative regulation of nitrogen compound metabolic process
GO:0050790	0.634	regulation of catalytic activity
GO:0048518	0.630	positive regulation of biological process
GO:0048522	0.546	positive regulation of cellular process
GO:0051246	0.539	regulation of protein metabolic process
GO:0048523	0.520	negative regulation of cellular process
GO:0048731	0.505	system development
GO:0051336	0.440	regulation of hydrolase activity
GO:0048513	0.417	animal organ development
GO:0051248	0.414	negative regulation of protein metabolic process
GO:0043086	0.406	negative regulation of catalytic activity
GO:0050896	0.390	response to stimulus
GO:0009653	0.389	anatomical structure morphogenesis
GO:0045861	0.385	negative regulation of proteolysis
GO:0048869	0.377	cellular developmental process
GO:0051346	0.357	negative regulation of hydrolase activity
GO:0052547	0.356	regulation of peptidase activity
GO:0010468	0.346	regulation of gene expression
GO:0030154	0.333	cell differentiation
GO:0048583	0.330	regulation of response to stimulus
GO:0010466	0.310	negative regulation of peptidase activity
GO:0051716	0.305	cellular response to stimulus
GO:0052548	0.302	regulation of endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0032991	0.999	protein-containing complex
GO:0043227	0.992	membrane-bounded organelle
GO:0005886	0.983	plasma membrane
GO:0005576	0.948	extracellular region
GO:0005622	0.915	intracellular anatomical structure
GO:0031982	0.879	vesicle
GO:0070062	0.867	extracellular exosome
GO:0005737	0.858	cytoplasm
GO:0043229	0.804	intracellular organelle
GO:0070161	0.787	anchoring junction
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0005829	0.413	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]