StarFunc result for job id Q5J8M3

User Input

>input (183 residues)
MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQET
DRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATF
KMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGG
LLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5J8M3	1.000	1.000	1.125E-26	183	1.000	1.000	Q5J8M3.pdb.gz	EMC4_HUMAN ER membrane protein complex subunit 4 OS=Homo sapiens OX=9606 GN=EMC4 PE=1 SV=2
2	AFDB:Q9VNQ3	0.648	0.710	1.684E-12	166	0.492	0.542	Q9VNQ3.pdb.gz	Q9VNQ3_DROME ER membrane protein complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=EMC4 PE=1 SV=1
3	AFDB:O94520	0.563	0.536	6.005E-8	193	0.273	0.259	O94520.pdb.gz	YQ13_SCHPO ER membrane protein complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1281.03c PE=3 SV=1
4	AFDB:A8MQD8	0.495	0.486	4.018E-7	187	0.333	0.326	A8MQD8.pdb.gz	A8MQD8_ARATH ER membrane protein complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=At5g10780 PE=1 SV=1
5	PDB:6z3wD	0.377	0.715	1.305E-6	84	0.459	1.000	6z3wD.pdb.gz
6	AFDB:Q584P6	0.592	0.742	2.049E-6	143	0.213	0.273	Q584P6.pdb.gz	Q584P6_TRYB2 ER membrane protein complex subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1350 PE=3 SV=1
7	AFDB:P53073	0.538	0.520	2.284E-6	190	0.224	0.216	P53073.pdb.gz	EMC4_YEAST ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMC4 PE=1 SV=1
8	PDB:6wb94	0.459	0.557	3.321E-4	148	0.230	0.284	6wb94.pdb.gz
9	AFDB:Q96KR6	0.177	0.172	1.258E-1	192	0.153	0.146	Q96KR6.pdb.gz	F210B_HUMAN Protein FAM210B, mitochondrial OS=Homo sapiens OX=9606 GN=FAM210B PE=1 SV=2
10	AFDB:Q9FNA1	0.183	0.140	1.480E-1	262	0.164	0.115	Q9FNA1.pdb.gz	Q9FNA1_ARATH Uncharacterized protein At5g13720 OS=Arabidopsis thaliana OX=3702 GN=MSH12.19 PE=1 SV=1
11	AFDB:Q0E917	0.292	0.057	2.413E-1	1200	0.131	0.020	Q0E917.pdb.gz	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
12	AFDB:Q8CII8	0.341	0.199	2.840E-1	388	0.142	0.067	Q8CII8.pdb.gz	SYNE4_MOUSE Nesprin-4 OS=Mus musculus OX=10090 GN=Syne4 PE=1 SV=1
13	PDB:5ynxA	0.282	0.418	1.085	117	0.077	0.120	5ynxA.pdb.gz
14	PDB:1keyB	0.246	0.213	1.770	221	0.104	0.086	1keyB.pdb.gz
15	PDB:2jmhA	0.271	0.358	2.083	117	0.093	0.145	2jmhA.pdb.gz
16	PDB:6mdmH	0.212	0.246	2.733	147	0.109	0.136	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
17	PDB:7eebM	0.318	0.456	2.733	116	0.049	0.078	7eebM.pdb.gz	Structure of a mammalian sperm cation channel complex.
18	PDB:7lbmn	0.181	0.133	2.733	283	0.066	0.042	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:7np7D4	0.363	0.174	3.396	415	0.077	0.034	7np7D4.pdb.gz
20	PDB:7nsuD	0.154	0.078	3.396	420	0.038	0.017	7nsuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5J8M3	1.47e-134	375	183	1.000	1.000	EMC4_HUMAN ER membrane protein complex subunit 4 OS=Homo sapiens OX=9606 GN=EMC4 PE=1 SV=2
2	Q9VNQ3	1.93e-53	169	166	0.475	0.524	Q9VNQ3_DROME ER membrane protein complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=EMC4 PE=1 SV=1
3	O94520	9.46e-20	84.0	193	0.230	0.218	YQ13_SCHPO ER membrane protein complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1281.03c PE=3 SV=1
4	A8MQD8	3.17e-16	74.7	187	0.333	0.326	A8MQD8_ARATH ER membrane protein complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=At5g10780 PE=1 SV=1
5	P53073	1.41e-15	73.2	190	0.246	0.237	EMC4_YEAST ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EMC4 PE=1 SV=1
6	Q584P6	1.24e-14	69.3	143	0.235	0.301	Q584P6_TRYB2 ER membrane protein complex subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1350 PE=3 SV=1
7	P60852	1.7	31.6	638	0.098	0.028	ZP1_HUMAN Zona pellucida sperm-binding protein 1 OS=Homo sapiens OX=9606 GN=ZP1 PE=1 SV=1
8	A6NFX1	2.2	31.2	504	0.104	0.038	MFS2B_HUMAN Sphingosine-1-phosphate transporter MFSD2B OS=Homo sapiens OX=9606 GN=MFSD2B PE=1 SV=4
9	Q9T072	3.7	30.4	328	0.115	0.064	BH025_ARATH Transcription factor bHLH25 OS=Arabidopsis thaliana OX=3702 GN=BHLH25 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06417 DUF1077	6.5e-42	153.6	Protein of unknown function (DUF1077)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010622901.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010609683.1	0.999	Transmembrane protein 93
2	885580.XP_010614026.1	0.999	Tetratricopeptide repeat protein 35
3	885580.XP_010617425.1	0.999	Belongs to the EMC3 family.
4	885580.XP_010622910.1	0.999	ER membrane protein complex subunit 7
5	885580.XP_010638971.1	0.999	UPF0510 protein INM02
6	885580.XP_010612523.1	0.998	Uncharacterized protein
7	885580.XP_010625795.1	0.997	Neighbor of COX4
8	885580.XP_010636022.1	0.995	UPF0172 protein FAM158A
9	885580.XP_010637094.1	0.984	Membrane magnesium transporter 1-like
10	885580.XP_010640794.1	0.984	Membrane magnesium transporter 1
11	885580.XP_010632230.1	0.715	Calcium-selective channel required to prevent calcium stores from overfilling
12	885580.XP_010628800.1	0.704	Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process
13	885580.XP_010607607.1	0.680	Prefoldin subunit 5
14	885580.XP_010640493.1	0.652	Uncharacterized protein
15	885580.XP_010635302.1	0.648	Integral membrane protein 2B
16	885580.XP_010635706.1	0.647	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns
17	885580.XP_010609275.1	0.621	TNFAIP3-interacting protein 3 isoform X1
18	885580.XP_010643874.1	0.614	Belongs to the GST superfamily.
19	885580.XP_010621788.1	0.580	Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha- leucine ester residues
20	885580.XP_010627509.1	0.575	39S ribosomal protein L42, mitochondrial isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032977	1.000	membrane insertase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051234	0.927	establishment of localization
GO:0016043	0.917	cellular component organization
GO:0051641	0.911	cellular localization
GO:0006996	0.911	organelle organization
GO:0045048	0.870	protein insertion into ER membrane
GO:0071816	0.374	tail-anchored membrane protein insertion into ER membrane
GO:0045050	0.312	protein insertion into ER membrane by stop-transfer membrane-anchor sequence

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:0098796	0.998	membrane protein complex
GO:0140534	0.998	endoplasmic reticulum protein-containing complex
GO:0072546	0.994	EMC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]