StarFunc result for job id Q5JPB2

User Input

>input (1677 residues)
MEVPEPTCPAPPARDQPAPTPGPPGAPGGQASPHLTLGPVLLPPEQGLAPPTVFLKALPI
PLYHTVPPGGLQPRAPLVTGSLDGGNVPFILSPVLQPEGPGPTQVGKPAAPTLTVNIVGT
LPVLSPGLGPTLGSPGKVRNAGKYLCPHCGRDCLKPSVLEKHIRSHTGERPFPCATCGIA
FKTQSNLYKHRRTQTHLNNSRLSSESEGAGGGLLEEGDKAGEPPRPEGRGESRCQGMHEG
ASERPLSPGAHVPLLAKNLDVRTEAAPCPGSAFADREAPWDSAPMASPGLPAASTQPWRK
LPEQKSPTAGKPCALQRQQATAAEKPWDAKAPEGRLRKCESTDSGYLSRSDSAEQPHAPC
SPLHSLSEHSAESEGEGGPGPGPGVAGAEPGAREAGLELEKKRLEERIAQLISHNQAVVD
DAQLDNVRPRKTGLSKQGSIDLPTPYTYKDSFHFDIRALEPGRRRAPGPVRSTWTPPDKS
RPLFFHSVPTQLSTTVECVPVTRSNSLPFVEGSRTWLEPREPRDPWSRTQKPLSPRPGPA
RLGCRSGLSSTDVPSGHPRALVRQAAVEDLPGTPIGDALVPAEDTDAKRTAAREAMAGKG
RAGGRKCGQRRLKMFSQEKWQVYGDETFKRIYQKMKASPHGGKKAREVGMGSGAELGFPL
QKEAAGSSGTVPTQDRRTPVHEDISAGATPEPWGNPPALEASLVTEPTKHGETVARRGDS
DRPRVEEAVSSPALGGRDSPCSGSRSPLVSPNGRLELGWQMPPAPGPLKGGDVEAPRPVW
PDPKLEGGARGVGDVQETCLWAQTVLRWPSRGSGEDKLPSERKKLKVEDLHSWKQPEPVS
AETPGGPTQPASLSSQKQDADPGEVPGGSKESARQVGEPLESSGASLAAASVALKRVGPR
DKATPLHPAAPAPAEHPSLATPPQAPRVLSALADNAFSPKYLLRLPQAETPLPLPIPWGP
RHSQDSLCSSGWPEERASFVGSGLGTPLSPSPASGPSPGEADSILEDPSCSRPQDGRKGA
QLGGDKGDRMATSRPAARELPISAPGAPREATSSPPTPTCEAHLVQDMEGDSHRIHRLCM
GSTLARARLSGDVLNPWVPNWELGEPPGNAPEDPSSGPLVGPDPCSPLQPGSFLTALTRP
QGVPPGWPELALSSHSGTSRSHSTRSPHSTQNPFPSLKAEPRLTWCCLSRSVPLPAEQKA
KAASVYLAVHFPGSSLRDEGPNGPPGSNGGWTWTSPGEGGPAQMSKFSYPTVPGVMPQHQ
VSEPEWKKGLPWRAKMSRGNSKQRKLKINPKRYKGNFLQSCVQLRASRLRTPTWVRRRSR
HPPALEGLKPCRTPGQTSSEIAGLNLQEEPSCATSESPPCCGKEEKKEGDCRQTLGTLSL
GTSSRIVREMDKRTVKDISPSAGEHGDCTTHSTAATSGLSLQSDTCLAVVNDVPLPPGKG
LDLGLLETQLLASQDSVSTDPKPYIFSDAQRPSSFGSKGTFPHHDIATSVAAVCISLPVR
TDHIAQEIHSAESRDHSQTAGRTLTSSSPDSKVTEEGRAQTLLPGRPSSGQRISDSVPLE
STEKTHLEIPASGPSSASSHHKEGRHKTFFPSRGQYGCGEMTVPCPSLGSDGRKRQVSGL
ITRKDSVVPSKPEQPIEIPEAPSKSLKKRSLEGMRKQTRVEFSDTSSDDEDRLVIEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A884	0.049	0.039	3.031E-14	2348	0.204	0.146	A2A884.pdb.gz	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
2	AFDB:P31629	0.045	0.034	2.363E-10	2446	0.196	0.135	P31629.pdb.gz	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
3	AFDB:Q5T1R4	0.049	0.036	3.293E-10	2406	0.215	0.150	Q5T1R4.pdb.gz	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
4	AFDB:Q14966	0.039	0.034	3.132E-6	1978	0.149	0.126	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
5	AFDB:Q7TSH3	0.040	0.057	8.477E-6	1157	0.114	0.165	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
6	AFDB:Q6P5H2	0.034	0.032	3.197E-5	1864	0.132	0.119	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
7	AFDB:F1QH64	0.030	0.039	4.170E-5	1225	0.108	0.148	F1QH64.pdb.gz
8	AFDB:Q99PP2	0.029	0.024	7.578E-5	2237	0.175	0.131	Q99PP2.pdb.gz	ZN318_MOUSE Zinc finger protein 318 OS=Mus musculus OX=10090 GN=Znf318 PE=1 SV=3
9	AFDB:Q6P1D7	0.027	0.028	1.796E-4	1565	0.146	0.157	Q6P1D7.pdb.gz	SLX4_MOUSE Structure-specific endonuclease subunit SLX4 OS=Mus musculus OX=10090 GN=Slx4 PE=1 SV=1
10	AFDB:O75362	0.040	0.053	5.195E-4	1048	0.098	0.156	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
11	PDB:3w5kB	0.027	0.249	5.103E-2	110	0.014	0.218	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4btsA9	0.018	0.193	3.816	93	0.009	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
13	PDB:4v6iBl	0.025	0.151	3.816	88	0.008	0.159	4v6iBl.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
14	PDB:4v6wCj	0.024	0.192	3.816	92	0.011	0.196	4v6wCj.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:7odr0	0.021	0.182	4.078	110	0.008	0.127	7odr0.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
16	PDB:6yxyAo	0.022	0.107	5.319	184	0.008	0.076	6yxyAo.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
17	PDB:7pntO	0.024	0.119	5.319	197	0.010	0.081	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:7dcpy	0.014	0.269	6.936	62	0.006	0.161	7dcpy.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:6htsR	0.017	0.253	7.412	72	0.007	0.153	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
20	PDB:4yrvA	0.021	0.081	7.921	288	0.008	0.049	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M9H4	1.17e-54	214	2574	0.111	0.072	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
2	F8VPM9	1.83e-34	147	2688	0.065	0.041	F8VPM9_MOUSE Human immunodeficiency virus type I enhancer binding protein 1 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
3	Q03172	1.99e-34	147	2688	0.065	0.041	ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
4	P15822	4.24e-34	146	2718	0.076	0.047	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
5	F5H212	4.57e-34	146	2717	0.076	0.047	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
6	Q3UHF7	1.44e-20	102	2430	0.049	0.034	ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus OX=10090 GN=Hivep2 PE=1 SV=1
7	Q5T1R4	1.46e-20	102	2406	0.027	0.019	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
8	P31629	1.93e-20	101	2446	0.048	0.033	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
9	Q00900	3.01e-20	100	2437	0.048	0.033	ZEP2_RAT Human immunodeficiency virus type I enhancer-binding protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Hivep2 PE=1 SV=2
10	Q8MQL7	5.09e-20	98.6	585	0.023	0.065	Q8MQL7_DROME SD06302p OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
11	A0A0B4KFC0	2.13e-19	98.2	2587	0.026	0.017	A0A0B4KFC0_DROME Schnurri, isoform F OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
12	A1Z8F4	2.17e-19	98.2	2577	0.026	0.017	A1Z8F4_DROME Schnurri, isoform D OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
13	Q24605	2.22e-19	98.2	2529	0.026	0.017	Q24605_DROME Zinc finger protein OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
14	Q24107	2.23e-19	98.2	2527	0.026	0.017	Q24107_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
15	Q0E9C5	2.25e-19	98.2	2532	0.026	0.017	Q0E9C5_DROME Schnurri, isoform A OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
16	Q7JM44	5.80e-13	77.0	2242	0.020	0.015	SMA9_CAEEL Transcription factor sma-9 OS=Caenorhabditis elegans OX=6239 GN=sma-9 PE=1 SV=2
17	A2A884	1.17e-12	75.9	2348	0.018	0.013	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
18	Q6Y8G5	7.86e-11	67.0	276	0.020	0.123	Q6Y8G5_HUMAN SALL4C OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
19	Q9UJQ4	4.80e-10	67.0	1053	0.020	0.032	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
20	Q8CIP9	1.17e-09	63.5	271	0.016	0.096	Q8CIP9_MOUSE KRAB zinc finger protein 6D (Fragment) OS=Mus musculus OX=10090 GN=Zfp640 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	0.0074	27.8	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	9.4	18.4	C2H2-type zinc finger
3	PF12171 zf-C2H2_jaz	3.2	19.4	Zinc-finger double-stranded RNA-binding
4	PF05605 zf-Di19	2.9e+02	13.2	Drought induced 19 protein (Di19), zinc-binding
5	PF13465 zf-H2C2_2	0.01	27.5	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360069

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348206	0.763	PRELI domain containing protein 3B
2	9606.ENSP00000217133	0.693	Tubulin beta-1 chain
3	9606.ENSP00000369519	0.681	S-methyl-5'-thioadenosine phosphorylase
4	9606.ENSP00000337128	0.633	Endothelin-3
5	9606.ENSP00000324856	0.620	Serine/threonine-protein kinase STK11
6	9606.ENSP00000424571	0.609	Fibrillin-2
7	9606.ENSP00000352420	0.603	Low-density lipoprotein receptor class A domain-containing protein 4
8	9606.ENSP00000375909	0.598	A-kinase anchor protein SPHKAP
9	9606.ENSP00000217131	0.560	Cathepsin Z
10	9606.ENSP00000379845	0.539	4-aminobutyrate aminotransferase, mitochondrial
11	9606.ENSP00000329214	0.536	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
12	9606.ENSP00000432417	0.536	Olfactory receptor 5M11
13	9606.ENSP00000360379	0.519	Protein FAM209A
14	9606.ENSP00000334319	0.513	Protein piccolo
15	9606.ENSP00000359114	0.509	Collagen alpha-1(XI) chain
16	9606.ENSP00000264596	0.503	Endonuclease 8-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.854	heterocyclic compound binding
GO:0097159	0.853	organic cyclic compound binding
GO:0003677	0.843	DNA binding
GO:1990837	0.340	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.943	regulation of cellular process
GO:0009987	0.934	cellular process
GO:0060255	0.655	regulation of macromolecule metabolic process
GO:0051171	0.600	regulation of nitrogen compound metabolic process
GO:0080090	0.581	regulation of primary metabolic process
GO:0031323	0.526	regulation of cellular metabolic process
GO:0032501	0.492	multicellular organismal process
GO:0010468	0.487	regulation of gene expression
GO:0008152	0.441	metabolic process
GO:0044238	0.419	primary metabolic process
GO:0071704	0.397	organic substance metabolic process
GO:0048519	0.380	negative regulation of biological process
GO:0032502	0.340	developmental process
GO:0048518	0.340	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.976	nucleoplasm
GO:0005737	0.788	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]