StarFunc result for job id Q5JPE7

User Input

>input (1267 residues)
MLVGQGAGLLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIVATGFSVCGRISIIRFP
DTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLK
PQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
AVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQA
ASDNSGPEDAKRQAKKQKTRRTLRLQEEFQLMWCLVPWRGTLGIHLFSSLPFASEILLET
TATCIHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JPE7	0.999	0.999	0.000	1267	1.000	1.000	Q5JPE7.pdb.gz	NOMO2_HUMAN BOS complex subunit NOMO2 OS=Homo sapiens OX=9606 GN=NOMO2 PE=1 SV=1
2	AFDB:X1WEJ6	0.788	0.823	0.000	1208	0.663	0.695	X1WEJ6.pdb.gz	X1WEJ6_DANRE Nodal modulator OS=Danio rerio OX=7955 GN=nomo PE=1 SV=1
3	AFDB:A1Z843	0.501	0.525	7.535E-102	1199	0.290	0.306	A1Z843.pdb.gz	A1Z843_DROME Nodal modulator 3 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1371 PE=1 SV=1
4	AFDB:Q9LZQ4	0.391	0.403	5.629E-92	1227	0.277	0.286	Q9LZQ4.pdb.gz	Q9LZQ4_ARATH Carbohydrate-binding-like fold OS=Arabidopsis thaliana OX=3702 GN=T12C14_60 PE=1 SV=1
5	AFDB:H2KYE0	0.401	0.444	1.228E-85	1123	0.223	0.251	H2KYE0.pdb.gz	NRA4_CAEEL Nicotinic receptor-associated protein 4 OS=Caenorhabditis elegans OX=6239 GN=nra-4 PE=1 SV=1
6	AFDB:A0A2R8QL08	0.078	0.057	7.359E-17	2036	0.122	0.076	A0A2R8QL08.pdb.gz
7	AFDB:Q2EY15	0.049	0.051	2.199E-13	1191	0.100	0.107	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
8	AFDB:A0A023GPK8	0.061	0.058	3.023E-13	1447	0.100	0.088	A0A023GPK8.pdb.gz	A0A023GPK8_DROME Friend of echinoid, isoform H OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1
9	AFDB:Q57XH9	0.091	0.069	4.350E-13	2194	0.103	0.060	Q57XH9.pdb.gz	Q57XH9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.25L8.40 PE=4 SV=1
10	AFDB:O00533	0.071	0.073	1.864E-12	1208	0.103	0.108	O00533.pdb.gz	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
11	PDB:5a42A	0.066	0.057	1.040E-9	1597	0.088	0.070	5a42A.pdb.gz
12	PDB:7q1yA	0.051	0.048	4.664E-9	1374	0.073	0.067	7q1yA.pdb.gz
13	PDB:3rfzB	0.071	0.105	5.277E-7	778	0.071	0.116	3rfzB.pdb.gz
14	PDB:7q5zA	0.046	0.044	6.330E-7	1344	0.065	0.061	7q5zA.pdb.gz
15	PDB:4rtdA	0.047	0.051	6.625E-7	1122	0.052	0.059	4rtdA.pdb.gz
16	PDB:1e07A	0.046	0.074	7.593E-7	642	0.050	0.098	1e07A.pdb.gz
17	PDB:5oj2B	0.068	0.086	1.645E-6	692	0.079	0.145	5oj2B.pdb.gz
18	PDB:7nycA	0.055	0.049	1.801E-6	1542	0.069	0.057	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:6h03A	0.052	0.053	2.161E-6	1223	0.065	0.067	6h03A.pdb.gz
20	PDB:4ziqA	0.063	0.057	7.374E-6	1450	0.081	0.071	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z843	0.0	598	1199	0.306	0.324	A1Z843_DROME Nodal modulator 3 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1371 PE=1 SV=1
2	P69849	0.0	2504	1222	0.962	0.998	NOMO3_HUMAN BOS complex subunit NOMO3 OS=Homo sapiens OX=9606 GN=NOMO3 PE=1 SV=2
3	Q15155	0.0	2502	1222	0.959	0.994	NOMO1_HUMAN BOS complex subunit NOMO1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5
4	Q5JPE7	0.0	2609	1267	1.000	1.000	NOMO2_HUMAN BOS complex subunit NOMO2 OS=Homo sapiens OX=9606 GN=NOMO2 PE=1 SV=1
5	X1WEJ6	0.0	1767	1208	0.665	0.697	X1WEJ6_DANRE Nodal modulator OS=Danio rerio OX=7955 GN=nomo PE=1 SV=1
6	Q9LZQ4	9.10e-148	480	1227	0.265	0.274	Q9LZQ4_ARATH Carbohydrate-binding-like fold OS=Arabidopsis thaliana OX=3702 GN=T12C14_60 PE=1 SV=1
7	H2KYE0	5.19e-101	349	1123	0.232	0.262	NRA4_CAEEL Nicotinic receptor-associated protein 4 OS=Caenorhabditis elegans OX=6239 GN=nra-4 PE=1 SV=1
8	Q95SU3	1.23e-49	181	319	0.083	0.329	Q95SU3_DROME SD07707p OS=Drosophila melanogaster OX=7227 GN=CG1371 PE=2 SV=1
9	A5FB63	1.5	35.8	1578	0.049	0.039	CHIA_FLAJ1 Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
10	O86488	2.4	35.0	1315	0.033	0.032	SDRD_STAAE Serine-aspartate repeat-containing protein D OS=Staphylococcus aureus (strain Newman) OX=426430 GN=sdrD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13715 CarbopepD_reg_2	7.7e-16	69.2	CarboxypepD_reg-like domain
2	PF13620 CarboxypepD_reg	1.9e-42	154.8	Carboxypeptidase regulatory-like domain
3	PF13473 Cupredoxin_1	2.6e+02	13.1	Cupredoxin-like domain
4	PF00775 Dioxygenase_C	3.4	18.6	Dioxygenase
5	PF07210 DUF1416	0.033	25.4	Protein of unknown function (DUF1416)
6	PF11008 DUF2846	1.1	20.6	Protein of unknown function (DUF2846)
7	PF10670 DUF4198	0.091	24.6	Domain of unknown function (DUF4198)
8	PF20598 DUF6795	1.3e-06	40.1	Domain of unknown function (DUF6795)
9	PF09430 EMC7_beta-sandw	2.6e-18	77.7	ER membrane protein complex subunit 7, beta-sandwich domain
10	PF14686 fn3_3	7.1e-07	40.3	Polysaccharide lyase family 4, domain II
11	PF16371 MetallophosN	1.8e+02	13.8	N terminal of Calcineurin-like phosphoesterase
12	PF17210 SdrD_B	7e-25	98.8	SdrD B-like domain
13	PF17802 SpaA	7.2e-19	78.9	Prealbumin-like fold domain
14	PF01060 TTR-52	0.41	22.5	Transthyretin-like family
15	PF06427 UDP-g_GGTase	2.2e+02	13.4	UDP-glucose:Glycoprotein Glucosyltransferase
16	PF07495 Y_Y_Y	0.037	25.3	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246117	0.959	Nicalin
2	9606.ENSP00000222284	0.947	Acts as a negative regulator of CHRM3 function, most likely by interfering with its trafficking to the cell membrane . Negatively regulates CHRM3-mediated calcium mobilization and activation of RPS6KA1/p90RSK activity
3	9606.ENSP00000261381	0.773	Xylosyltransferase 1
4	9606.ENSP00000259708	0.714	Kinesin light chain 4
5	9606.ENSP00000205557	0.694	Multidrug resistance-associated protein 6
6	9606.ENSP00000294785	0.641	Nicastrin
7	9606.ENSP00000223127	0.596	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
8	9606.ENSP00000295171	0.560	Coiled-coil domain containing 74A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043022	1.000	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.984	regulation of biological process
GO:0050794	0.947	regulation of cellular process
GO:0009987	0.816	cellular process
GO:0008152	0.785	metabolic process
GO:0071704	0.698	organic substance metabolic process
GO:0048583	0.673	regulation of response to stimulus
GO:0044238	0.669	primary metabolic process
GO:0006807	0.651	nitrogen compound metabolic process
GO:0043170	0.637	macromolecule metabolic process
GO:1901564	0.534	organonitrogen compound metabolic process
GO:0044237	0.460	cellular metabolic process
GO:0019538	0.411	protein metabolic process
GO:0009966	0.410	regulation of signal transduction
GO:0048519	0.352	negative regulation of biological process
GO:0090101	0.312	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032925	0.309	regulation of activin receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.998	endomembrane system
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005737	0.990	cytoplasm
GO:0031090	0.989	organelle membrane
GO:0032991	0.969	protein-containing complex
GO:0031984	0.960	organelle subcompartment
GO:0042175	0.942	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.930	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]