StarFunc result for job id Q5JPF3

User Input

>input (1778 residues)
MDDKEPKRWPTLRDRLCSDGFLFPQYPIKPYHLKGIHRAVFYRDLEELKFVLLTRYDINK
RDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQN
GADPNITDVFGRTALHYAVYNEDTSMIEKLLSYGANIEECSEDEYPPLFLAVSQRKVKMV
EFLLKKKANINAVDYLGRSALIHAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEA
KNRVIFELIYEYERKKHEELSINSNPVSSQKQPALKATSGKEDSISNIATEIKDGQKSGT
VSSQKQPALKGTSDKNDSVSNTATEIKDEQKSGTVSSQKQPALKDTSDKNDSVSNTATEI
KDEQKSGTVLPAVEQCLNRSLYRPDAVAQPVTEDEFALESEIISKLYIPKRKIISPRSIE
DVLPPVEEAVDRCLYLLDRFAQAVTKDKFALESENISEPYFTNRRTISQQSAEKLDAACG
IDKTENGTLFEDQNVDKEGKALPATGQKANVSPEQPPLFTHTVKDSDHISTRFLGSMDSL
TSSEESSERPPLSTLTLKEADPSSKAAMRRKDSPPPGKVSSQKQPAEKATSDDKDSVSNI
ATEIKEGPISGTVSSQKQPAEKATSDEKDSVSNIATEIKEGQQSGTVSPQKQSAWKVIFK
KKVSLLNIATRITGGGKSGTVSSQKQPPSKATSDKTDSALNIATEIKDGLQCGTVSSQKQ
PALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQPALKATTDEEDSVSIIATEIKDGEKS
GTVSSRKKPALKATSDEKDSFSNITREKKDGEISRTVTSEKPAGLKATSDEEDSVLNIAR
GKEDGEKTRRVSSRKKPALKATSDEKDSFSNITREKKDGETSRTVSSQKPPALKATSDEE
DSVLNIAREKKDGEKSRTVSSEKPSGLKATSDEKDSVLNIARGKKHGEKTRRVSSHKQPA
LKATSDKENSVPNMATETKDEQISGTVSSQKQPALKATSDKKDSVSNIPTEIKDGQQSGT
VSSQKQLAWKATSVKKDSVSNIATEIKDGQIRGTVSSQRQPALKATGDEKDSVSNIAREI
KDGEKSGTVSPQKQSAQKVIFKKKVSLLNIATRITGGWKSGTEYPENLPTLKATIENKNS
VLNTATKMKDVQTSTPEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDIIQSSQT
VSEDGDSLCCNCKNVILLIDQHEMKCKDCVHLLKIKKTFCLCKRLTELKDNHCEQLRVKI
RKLKNKASVLQKRLSEKEEIKSQLKHETLELEKELCSLRFAIQQEKKKRRNVEELHQKVR
EKLRITEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHENRLMQDE
IARLRLEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNEETLAETIACYSGQLAALT
DENTTLRSKLEKQRESGQRLETEMQSYRCRLNAALCDHDQSHSSKRDQELAFQGTVDKCC
HLQENLNSHVLILSLQLSKAESKFRVLETELHYTGEALKEKALVFEHVQSELKQKQSQMK
DIEKMYKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNIQARCDA
RVENLQAECRKHRLLLEEDNKMLVNELNHSKEKKCQYEKEKAEREVAVRQLQQKQDDVLN
KRSATKALLDASSRHCIYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGDAQK
LEVENVMMRKIIKKQDEQIERFEKILQHSSLMLQVFES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2N9	0.153	0.196	0.000	1353	0.711	0.934	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
2	AFDB:Q8WXD9	0.123	0.151	3.190E-15	1431	0.111	0.138	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
3	PDB:8cs9A	0.121	0.265	3.989E-15	796	0.035	0.078	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	AFDB:Q8IQN4	0.077	0.105	4.149E-15	1144	0.101	0.157	Q8IQN4.pdb.gz	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
5	AFDB:M9PCQ3	0.078	0.108	5.396E-15	1111	0.097	0.156	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
6	PDB:2dvwA	0.118	0.825	5.530E-14	229	0.033	0.253	2dvwA.pdb.gz
7	AFDB:F1QJ05	0.121	0.142	1.646E-13	1509	0.106	0.125	F1QJ05.pdb.gz
8	AFDB:A2A690	0.104	0.093	1.422E-12	1994	0.083	0.074	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
9	PDB:4oauC	0.115	0.281	4.347E-12	692	0.035	0.090	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
10	PDB:6v9hC	0.107	0.640	1.258E-10	270	0.026	0.170	6v9hC.pdb.gz
11	AFDB:A1Z9K8	0.126	0.120	1.379E-10	1871	0.111	0.106	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
12	PDB:1wg0A	0.112	0.715	2.019E-10	243	0.029	0.214	1wg0A.pdb.gz
13	PDB:5vkqA	0.116	0.136	2.243E-10	1499	0.031	0.037	5vkqA.pdb.gz
14	AFDB:D3YZU1	0.126	0.104	6.337E-10	2167	0.118	0.096	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
15	AFDB:Q9JLU4	0.122	0.124	2.621E-9	1740	0.110	0.113	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
16	PDB:6jd6B	0.093	0.773	8.902E-9	192	0.028	0.255	6jd6B.pdb.gz
17	PDB:6aunA	0.108	0.281	1.042E-8	618	0.027	0.078	6aunA.pdb.gz
18	PDB:1bu9A	0.074	0.588	1.429E-8	168	0.024	0.256	1bu9A.pdb.gz
19	PDB:6mwqA	0.081	0.281	2.294E-8	493	0.029	0.103	6mwqA.pdb.gz
20	AFDB:Q6UB99	0.074	0.051	7.198E-8	2663	0.105	0.070	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N2N9	0.0	1939	1353	0.557	0.732	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
2	A1A5B0	2.98e-164	503	309	0.133	0.764	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
3	Q9UPS8	1.02e-159	535	1710	0.177	0.184	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
4	Q811D2	1.88e-111	393	1581	0.142	0.159	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
5	A0JP26	5.12e-65	234	581	0.066	0.201	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
6	Q5TYW2	3.57e-62	232	823	0.063	0.136	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
7	Q6S8J3	5.24e-61	231	1075	0.065	0.108	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
8	A5A3E0	5.67e-61	231	1075	0.065	0.108	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	P0CG39	3.16e-59	226	1038	0.064	0.110	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
10	P0CG38	3.72e-59	226	1075	0.064	0.106	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
11	Q9D504	8.86e-56	197	279	0.056	0.355	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
12	Q6NSI1	7.34e-48	176	321	0.049	0.274	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
13	A0A140VJE5	7.83e-47	171	254	0.051	0.354	A0A140VJE5_HUMAN Testicular tissue protein Li 19 OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q92527	7.83e-47	171	254	0.051	0.354	ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=2 SV=3
15	C9JIJ7	2.40e-46	170	263	0.051	0.342	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
16	Q96IX9	2.94e-39	144	119	0.043	0.639	A26L1_HUMAN Putative ankyrin repeat domain-containing protein 26-like 1 OS=Homo sapiens OX=9606 GN=ANKRD36BP1 PE=5 SV=1
17	Q8GZ22	1.00e-21	98.6	240	0.033	0.246	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
18	Q54KA7	7.99e-20	99.4	986	0.039	0.070	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
19	Q9ULJ7	9.96e-19	95.9	1429	0.043	0.053	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
20	Q8N8A2	1.72e-18	94.7	993	0.035	0.063	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	6.6e-18	75.5	Ankyrin repeat
2	PF12796 Ank_2	1.9e-25	100.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	7.6e-17	70.5	Ankyrin repeat
4	PF13637 Ank_4	4.3e-27	105.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-16	71.3	Ankyrin repeats (many copies)
6	PF14915 CCDC144C	1.4e-100	347.9	CCDC144C protein coiled-coil region
7	PF19890 DUF6363	2.5e+02	12.9	Domain of unknown function (DUF6363)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418187	0.576	Zinc finger protein 717
2	9606.ENSP00000397188	0.560	Family with sequence similarity 104 member B
3	9606.ENSP00000391950	0.557	Ankyrin repeat domain-containing protein 36A
4	9606.ENSP00000447056	0.527	Uncharacterized protein
5	9606.ENSP00000429896	0.526	Protein FAM178B
6	9606.ENSP00000464265	0.524	Ubiquitin B pseudogene 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.841	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032501	0.965	multicellular organismal process
GO:0000003	0.857	reproduction
GO:0022414	0.752	reproductive process
GO:0007017	0.689	microtubule-based process
GO:0065007	0.518	biological regulation
GO:0071704	0.514	organic substance metabolic process
GO:0050789	0.433	regulation of biological process
GO:0050794	0.407	regulation of cellular process
GO:0032502	0.398	developmental process
GO:0043170	0.384	macromolecule metabolic process
GO:0006807	0.339	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.996	organelle
GO:0043227	0.980	membrane-bounded organelle
GO:0043229	0.977	intracellular organelle
GO:0005634	0.934	nucleus
GO:0043232	0.589	intracellular non-membrane-bounded organelle
GO:0071944	0.476	cell periphery
GO:0005737	0.373	cytoplasm
GO:0016020	0.357	membrane
GO:0031514	0.320	motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]