StarFunc result for job id Q5JPH6

User Input

>input (523 residues)
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYN
YIFAKKYQGSFILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQR
LELYAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRYDNRCRNMSQEQVAQKLA
KDPKPAIRFRLEQVVPAFQDLVYGWNRHEVASVEGDPVIMKSDGFPTYHLACVVDDHHMG
ISHVLRGSEWLVSTAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAAD
GFLPDSLLDIITNCGSGFAENQMGRTLPELITQFNLTQVTCHSALLDLEKLPEFNRLHLQ
RLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPV
YSYLWTRPAVGRAQLDAISEKVDVIAKRVLGLLERSSMSLTQDMLNGELKKLSEGLEGTK
YSNVMKLLRMALSGQQQGPPVAEMMLALGPKEVRERIQKVVSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JPH6	1.000	1.000	1.177E-90	523	1.000	1.000	Q5JPH6.pdb.gz	SYEM_HUMAN Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=EARS2 PE=1 SV=2
2	AFDB:Q9CXJ1	0.956	0.956	2.644E-81	523	0.851	0.851	Q9CXJ1.pdb.gz	SYEM_MOUSE Probable glutamate--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Ears2 PE=1 SV=1
3	AFDB:Q8MZ14	0.815	0.833	1.940E-49	511	0.442	0.452	Q8MZ14.pdb.gz	Q8MZ14_DROME Probable glutamate--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=GluRS-m PE=2 SV=1
4	AFDB:Q9HDX9	0.796	0.792	2.770E-40	526	0.338	0.337	Q9HDX9.pdb.gz	SYEM_SCHPO Glutamate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mse1 PE=3 SV=1
5	AFDB:P48525	0.801	0.783	3.066E-37	536	0.348	0.340	P48525.pdb.gz	SYEM_YEAST Glutamate--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSE1 PE=1 SV=2
6	AFDB:Q9FEA2	0.789	0.728	3.119E-36	570	0.315	0.289	Q9FEA2.pdb.gz	SYEM_ARATH Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA3 PE=1 SV=1
7	AFDB:Q97NG1	0.790	0.846	2.728E-35	486	0.277	0.298	Q97NG1.pdb.gz	SYE_STRPN Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gltX PE=1 SV=1
8	AFDB:Q8IDD3	0.752	0.692	5.254E-35	574	0.268	0.244	Q8IDD3.pdb.gz	Q8IDD3_PLAF7 glutamate--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1357200 PE=3 SV=1
9	AFDB:Q9CDZ7	0.783	0.843	1.012E-34	483	0.275	0.298	Q9CDZ7.pdb.gz	SYE_LACLA Glutamate--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=gltX PE=3 SV=1
10	AFDB:P9WFV9	0.794	0.843	2.050E-34	490	0.294	0.314	P9WFV9.pdb.gz	SYE_MYCTU Glutamate--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gltX PE=1 SV=1
11	PDB:2ja2A	0.777	0.833	1.886E-32	485	0.293	0.315	2ja2A.pdb.gz
12	PDB:4a91A	0.476	0.833	2.834E-20	290	0.191	0.345	4a91A.pdb.gz	Crystal Structure of Glutamyl-Queuosine Trnaasp Synthetase Complexed with L-Glutamate: Structural Elements Mediating tRNA-Independent Activation of Glutamate and Glutamylation of Trnaasp Anticodon.
13	PDB:4h3sA	0.439	0.396	1.146E-11	585	0.145	0.130	4h3sA.pdb.gz	The Structure of Yeast Glutaminyl-tRNA Synthetase and Modeling of Its Interaction with tRNA.
14	PDB:2hz7A	0.464	0.438	1.206E-11	556	0.140	0.131	2hz7A.pdb.gz
15	PDB:4jyzA	0.452	0.438	6.054E-11	542	0.119	0.114	4jyzA.pdb.gz	Structural and Mechanistic Basis for Enhanced Translational Efficiency by 2-Thiouridine at the tRNA Anticodon Wobble Position.
16	PDB:4ye6A	0.417	0.314	5.121E-9	709	0.134	0.099	4ye6A.pdb.gz
17	PDB:1u0bB	0.367	0.410	1.091E-8	461	0.117	0.132	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
18	PDB:1li7B	0.351	0.475	4.791E-7	375	0.080	0.112	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
19	PDB:6ax8A	0.332	0.340	1.381E-6	509	0.119	0.122	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
20	PDB:5yymA	0.317	0.289	8.487E-6	581	0.119	0.107	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JPH6	0.0	1075	523	1.000	1.000	SYEM_HUMAN Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=EARS2 PE=1 SV=2
2	Q9CXJ1	0.0	914	523	0.851	0.851	SYEM_MOUSE Probable glutamate--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Ears2 PE=1 SV=1
3	Q8MZ14	8.64e-152	446	511	0.457	0.468	Q8MZ14_DROME Probable glutamate--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=GluRS-m PE=2 SV=1
4	Q9VV59	9.23e-152	445	511	0.457	0.468	Q9VV59_DROME Probable glutamate--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=GluRS-m PE=3 SV=1
5	P48525	8.72e-93	295	536	0.348	0.340	SYEM_YEAST Glutamate--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSE1 PE=1 SV=2
6	Q9HDX9	2.82e-89	285	526	0.306	0.304	SYEM_SCHPO Glutamate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mse1 PE=3 SV=1
7	Q8IDD3	1.74e-71	240	574	0.226	0.206	Q8IDD3_PLAF7 glutamate--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1357200 PE=3 SV=1
8	Q9FEA2	2.91e-68	231	570	0.260	0.239	SYEM_ARATH Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA3 PE=1 SV=1
9	Q97NG1	3.85e-67	226	486	0.283	0.305	SYE_STRPN Glutamate--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gltX PE=1 SV=1
10	P04805	5.57e-67	225	471	0.293	0.325	SYE_ECOLI Glutamate--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=gltX PE=1 SV=1
11	Q9CDZ7	1.12e-65	222	483	0.233	0.253	SYE_LACLA Glutamate--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=gltX PE=3 SV=1
12	P9WFV9	1.09e-57	201	490	0.241	0.257	SYE_MYCTU Glutamate--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gltX PE=1 SV=1
13	P27305	1.58e-37	142	308	0.170	0.289	GLUQ_ECOLI Glutamyl-Q tRNA(Asp) synthetase OS=Escherichia coli (strain K12) OX=83333 GN=gluQ PE=1 SV=6
14	O82462	1.34e-16	85.5	719	0.153	0.111	SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g26710 PE=1 SV=1
15	P13188	2.49e-16	84.7	809	0.149	0.096	SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLN4 PE=1 SV=2
16	Q587C5	9.02e-14	76.3	607	0.132	0.114	Q587C5_TRYB2 glutamate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.450 PE=3 SV=1
17	P46655	4.24e-12	71.2	708	0.149	0.110	SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUS1 PE=1 SV=3
18	P28668	5.22e-12	71.2	1714	0.130	0.040	SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GluProRS PE=1 SV=2
19	Q9Y7Y8	1.33e-11	69.7	811	0.130	0.084	SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qrs1 PE=3 SV=1
20	O13775	1.80e-11	68.9	716	0.130	0.095	SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gus1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19269 Anticodon_2	5.5e-12	57.7	Anticodon binding domain
2	PF14246 TetR_C_7	2.8e+02	12.9	AefR-like transcriptional repressor, C-terminal domain
3	PF00749 tRNA-synt_1c	1.9e-84	294.8	tRNA synthetases class I (E and Q), catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395196

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360327	0.975	Probable proline--tRNA ligase, mitochondrial
2	9606.ENSP00000282276	0.955	Methionine--tRNA ligase, mitochondrial
3	9606.ENSP00000362576	0.952	Tyrosine--tRNA ligase, cytoplasmic
4	9606.ENSP00000263985	0.949	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
5	9606.ENSP00000358549	0.943	Probable arginine--tRNA ligase, mitochondrial
6	9606.ENSP00000262027	0.942	Methionine--tRNA ligase, cytoplasmic
7	9606.ENSP00000355086	0.930	Aspartate--tRNA ligase, mitochondrial
8	9606.ENSP00000355889	0.929	Isoleucine--tRNA ligase, mitochondrial
9	9606.ENSP00000408576	0.928	Probable leucine--tRNA ligase, mitochondrial
10	9606.ENSP00000281038	0.926	Probable asparagine--tRNA ligase, mitochondrial
11	9606.ENSP00000320658	0.918	Tyrosine--tRNA ligase, mitochondrial
12	9606.ENSP00000435370	0.903	Ubiquitin-like protein FUBI
13	9606.ENSP00000355890	0.899	Bifunctional glutamate/proline--tRNA ligase
14	9606.ENSP00000316335	0.880	Phenylalanine--tRNA ligase, mitochondrial
15	9606.ENSP00000307900	0.872	Glutamine synthetase
16	9606.ENSP00000261772	0.871	Alanine--tRNA ligase, cytoplasmic
17	9606.ENSP00000472847	0.866	Serine--tRNA ligase, mitochondrial
18	9606.ENSP00000377954	0.865	Leucine--tRNA ligase, cytoplasmic
19	9606.ENSP00000358042	0.856	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
20	9606.ENSP00000441000	0.851	Valine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	1.000	aminoacyl-tRNA ligase activity
GO:0004818	0.992	glutamate-tRNA ligase activity
GO:0005488	0.974	binding
GO:0005515	0.948	protein binding
GO:1901363	0.459	heterocyclic compound binding
GO:0097159	0.459	organic cyclic compound binding
GO:0003676	0.397	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006418	0.997	tRNA aminoacylation for protein translation
GO:0032543	0.938	mitochondrial translation
GO:0000959	0.928	mitochondrial RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.525	intracellular organelle lumen
GO:0032991	0.465	protein-containing complex
GO:0005829	0.422	cytosol
GO:0016020	0.327	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	1.000	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:23540	0.992	ATP + L-glutamate + tRNA(Glu) = AMP + diphosphate + L-glutamyl-tRNA(Glu)
EC:6.1.1.17	0.992	glutamate--tRNA ligase.

[back to server]