StarFunc result for job id Q5JR59

User Input

>input (1369 residues)
MSVPVAPKKSCYTQLRDNRNAARNNNESILSLGDTNANQIMLEVSSSHDESKTCDLGDEI
GNTNSSEPENRTHFHKEFHQLQGFGKGSQAGSASLKDFRLSSTIQRELNEEHTVERGTDS
LQTTRSIQGPSLSSWRNVMSEASLDVLAKRDAEIPRHVPKDKLAKTLDNEELRRHSLERA
SSSVAAVGSLTPQHPQPLSLDSREARGQIPGGGEGPQKTLPDHAVPAAFPATDSTSEGKS
VRHPKPSTSESKQSTPSETQTVGAHVLQVCSEHTSHSAHPEPALNLTLASKEIPSKLEAQ
LGQGKGEAKLDLKYVPPRRVEQEGKAAQEGYLGCHKEENLSALEGRDPCGEAHPEATDAL
GHLLNSDLHHLGVGRGNCEEKRGVNPGEQDSLHTTPKQGSASLGGADNQPTGKISPCAGE
KLGERTSSSFSPGDSHVAFIPNNLTDSKPLDVIEEERRLGSGNKDSVMVLVFNPSVGENK
TEVPEPLDPQSGRSEARESKEVTTSVAENRNLLENADKIESTSARADSVLNIPAPLHPET
TVNMTYQPTTPSSSFQDVSVFGMDAGSPLVVPPPTDSARLLNTSPKVPDKNTCPSGIPKP
VFTHSKDTPSSQEGMENYQVEKTEERTETKPIIMPKPKHVRPKIITYIRRNPQALGQVDA
SLVPVGLPYAPPTCTMPLPHEEKAAGGDLKPSANLYEKFKPDLQKPRVFSSGLMVSGIKP
PGHPFSQMSEKFLQEVTDHPGKEEFCSPPYAHYEVPPTFYRSAMLLKPQLGLGAMSRLPS
AKSRILIASQRSSASAIHPPGPITTATSLYSSDPSADLKKASSSNAAKSNLPKSGLRPPG
YSRLPAAKLAAFGFVRSSSVSSVSSTQSGDSAQPEQGRPATRSTFGNEEQPVLKASLPSK
DTPKGAGRVAPPASSSVTAPRRSLLPAPKSTSTPAGTKKDAQKDQDTNKPAVSSPKRVAA
STTKLHSPGYPKQRTAAARNGFPPKPDPQAREAERQLVLRLKERCEQQTRQLGVAQGELK
RAICGFDALAVATQHFFRKNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELER
RFEDEVKRLGWQQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTAS
HDAALLEMENNHTVAITILQDDHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLT
FQSQSLRDRARRFEEALRKNTEEQLEIALAPYQHLEEDMKSLKQVLEMKNQQIHEQEKKI
LELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQLSEENANLQEYVEKETQEKK
RLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JR59	0.999	0.999	0.000	1369	1.000	1.000	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
2	AFDB:Q7SZL5	0.161	0.164	4.495E-23	1338	0.226	0.232	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
3	AFDB:Q5HZI1	0.160	0.180	9.271E-23	1210	0.201	0.227	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
4	AFDB:Q9ULD2	0.157	0.167	7.504E-22	1270	0.210	0.226	Q9ULD2.pdb.gz	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
5	AFDB:Q9VQM0	0.103	0.070	6.632E-10	2162	0.194	0.123	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
6	AFDB:Q8BI84	0.086	0.065	2.934E-5	1930	0.173	0.123	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
7	AFDB:Q9JJG0	0.097	0.113	8.600E-4	1149	0.150	0.179	Q9JJG0.pdb.gz	TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus OX=10090 GN=Tacc2 PE=1 SV=2
8	AFDB:A0A0B4JD97	0.098	0.100	5.927E-3	1322	0.119	0.123	A0A0B4JD97.pdb.gz	A0A0B4JD97_DROME Transforming acidic coiled-coil protein, isoform K OS=Drosophila melanogaster OX=7227 GN=tacc PE=1 SV=1
9	AFDB:Q9XZL7	0.080	0.091	5.927E-3	1190	0.127	0.146	Q9XZL7.pdb.gz	Q9XZL7_DROME Transforming acidic coiled-coil containing protein OS=Drosophila melanogaster OX=7227 GN=tacc PE=2 SV=1
10	AFDB:Q4VXL8	0.109	0.134	1.436E-2	1038	0.124	0.164	Q4VXL8.pdb.gz	Q4VXL8_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
11	PDB:7r5jV0	0.037	0.166	5.525	273	0.028	0.139	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:5wlcST	0.046	0.095	8.261	599	0.014	0.032	5wlcST.pdb.gz	The complete structure of the small-subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JR59	0.0	2801	1369	1.000	1.000	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
2	Q5HZI1	1.36e-61	233	1210	0.099	0.112	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
3	Q7SZL5	3.15e-61	233	1338	0.129	0.132	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
4	Q9ULD2	2.63e-58	223	1270	0.104	0.113	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
5	Q6IMY1	2.28e-56	204	440	0.102	0.318	MTUS1_RAT Microtubule-associated tumor suppressor 1 homolog OS=Rattus norvegicus OX=10116 GN=Mtus1 PE=1 SV=1
6	A6NI79	4.38e-26	112	296	0.050	0.230	CCD69_HUMAN Coiled-coil domain-containing protein 69 OS=Homo sapiens OX=9606 GN=CCDC69 PE=1 SV=1
7	O46112	9.99e-07	56.2	2176	0.055	0.034	O46112_DROME Toucan protein OS=Drosophila melanogaster OX=7227 GN=toc PE=2 SV=1
8	Q9VQM0	1.17e-06	55.8	2162	0.055	0.035	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
9	Q8MRI5	3.21e-05	51.2	1103	0.054	0.067	Q8MRI5_DROME LD27161p OS=Drosophila melanogaster OX=7227 GN=toc PE=2 SV=1
10	Q8IPZ2	1.05e-04	49.3	984	0.054	0.075	Q8IPZ2_DROME LP24049p OS=Drosophila melanogaster OX=7227 GN=toc PE=2 SV=2
11	Q0E8U3	1.65e-04	48.5	945	0.054	0.078	Q0E8U3_DROME Toucan, isoform E OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
12	M9PCH2	3.10e-04	47.8	993	0.054	0.075	M9PCH2_DROME Toucan, isoform H OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
13	M9PC13	3.53e-04	47.8	936	0.054	0.079	M9PC13_DROME Toucan, isoform I OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
14	M9PED5	5.29e-04	47.0	892	0.054	0.083	M9PED5_DROME Toucan, isoform J OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
15	Q5DU05	6.05e-04	47.0	1446	0.050	0.047	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
16	Q59E61	8.32e-04	46.6	1342	0.071	0.072	Q59E61_DROME FI24227p1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
17	Q7YZB2	8.75e-04	46.6	1342	0.071	0.072	Q7YZB2_DROME Polo kinase kinase 1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=2 SV=1
18	Q8IPZ1	0.001	45.8	888	0.054	0.083	Q8IPZ1_DROME AT07210p OS=Drosophila melanogaster OX=7227 GN=toc PE=2 SV=1
19	M9PBW7	0.002	45.4	840	0.054	0.088	M9PBW7_DROME Toucan, isoform G OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
20	Q9VQL8	0.002	45.1	993	0.054	0.075	Q9VQL8_DROME Toucan, isoform B OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361298	0.885	Kinesin-like protein KIF2C
2	9606.ENSP00000364721	0.811	Microtubule-associated protein RP/EB family member 1
3	9606.ENSP00000299191	0.560	Uncharacterized protein C16orf78
4	9606.ENSP00000359050	0.535	UPF0668 protein C10orf76
5	9606.ENSP00000477706	0.532	Zinc finger protein 316
6	9606.ENSP00000405635	0.509	CTD nuclear envelope phosphatase 1 regulatory subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.923	cellular process
GO:0065007	0.877	biological regulation
GO:0050789	0.870	regulation of biological process
GO:0050794	0.827	regulation of cellular process
GO:0071840	0.450	cellular component organization or biogenesis
GO:0016043	0.435	cellular component organization
GO:0006996	0.343	organelle organization
GO:0000226	0.312	microtubule cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005813	0.996	centrosome
GO:0005881	0.996	cytoplasmic microtubule
GO:0045171	0.995	intercellular bridge
GO:0005829	0.866	cytosol
GO:0016020	0.823	membrane
GO:0071944	0.721	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]