StarFunc result for job id Q5JRA6

User Input

>input (1907 residues)
MAAAPGLLVWLLVLRLPWRVPGQLDPSTGRRFSEHKLCADDECSMLMYRGEALEDFTGPD
CRFVNFKKGDPVYVYYKLARGWPEVWAGSVGRTFGYFPKDLIQVVHEYTKEELQVPTDET
DFVCFDGGRDDFHNYNVEELLGFLELYNSAATDSEKAVEKTLQDMEKNPELSKEREPEPE
PVEANSEESDSVFSENTEDLQEQFTTQKHHSHANSQANHAQGEQASFESFEEMLQDKLKV
PESENNKTSNSSQVSNEQDKIDAYKLLKKEMTLDLKTKFGSTADALVSDDETTRLVTSLE
DDFDEELDTEYYAVGKEDEENQEDFDELPLLTFTDGEDMKTPAKSGVEKYPTDKEQNSNE
EDKVQLTVPPGIKNDDKNILTTWGDTIFSIVTGGEETRDTMDLESSSSEEEKEDDDDALV
PDSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQ
DKTELEDENQEGMTVHSSVHSNNLNSMPAAEKGKDTLKSAYDDTENDLKGAAIHISKGML
HEEKPGEQILEGGSESESAQKAAGNQMNDRKIQQESLGSAPLMGDDHPNASRDSVEGDAL
VNGAKLHTLSVEHQREELKEELVLKTQNQPRFSSPDEIDLPRELEDEVPILGRNLPWQQE
RDVAATASKQMSEKIRLSEGEAKEDSLDEEFFHHKAMQGTEVGQTDQTDSTGGPAFLSKV
EEDDYPSEELLEDENAINAKRSKEKNPGNQGRQFDVNLQVPDRAVLGTIHPDPEIEESKQ
ETSMILDSEKTSETAAKGVNTGGREPNTMVEKERPLADKKAQRPFERSDFSDSIKIQTPE
LGEVFQNKDSDYLKNDNPEEHLKTSGLAGEPEGELSKEDHENTEKYMGTESQGSAAAEPE
DDSFHWTPHTSVEPGHSDKREDLLIISSFFKEQQSLQRFQKYFNVHELEALLQEMSSKLK
SAQQESLPYNMEKVLDKVFRASESQILSIAEKMLDTRVAENRDLGMNENNIFEEAAVLDD
IQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPE
EPTHLDQRVIGDTHASEVSQKPNTEKDLDPGPVTTEDTPMDAIDANKQPETAAEEPASVT
PLENAILLIYSFMFYLTKSLVATLPDDVQPGPDFYGLPWKPVFITAFLGIASFAIFLWRT
VLVVKDRVYQVTEQQISEKLKTIMKENTELVQKLSNYEQKIKESKKHVQETRKQNMILSD
EAIKYKDKIKTLEKNQEILDDTAKNLRVMLESEREQNVKNQDLISENKKSIEKLKDVISM
NASEFSEVQIALNEAKLSEEKVKSECHRVQEENARLKKKKEQLQQEIEDWSKLHAELSEQ
IKSFEKSQKDLEVALTHKDDNINALTNCITQLNLLECESESEGQNKGGNDSDELANGEVG
GDRNEKMKNQIKQMMDVSRTQTAISVVEEDLKLLQLKLRASVSTKCNLEDQVKKLEDDRN
SLQAAKAGLEDECKTLRQKVEILNELYQQKEMALQKKLSQEEYERQEREHRLSAADEKAV
SAAEEVKTYKRRIEEMEDELQKTERSFKNQIATHEKKAHENWLKARAAERAIAEEKREAA
NLRHKLLELTQKMAMLQEEPVIVKPMPGKPNTQNPPRRGPLSQNGSFGPSPVSGGECSPP
LTVEPPVRPLSATLNRRDMPRSEFGSVDGPLPHPRWSAEASGKPSPSDPGSGTATMMNSS
SRGSSPTRVLDEGKVNMAPKGPPPFPGVPLMSTPMGGPVPPPIRYGPPPQLCGPFGPRPL
PPPFGPGMRPPLGLREFAPGVPPGRRDLPLHPRGFLPGHAPFRPLGSLGPREYFIPGTRL
PPPTHGPQEYPPPPAVRDLLPSGSRDEPPPASQSTSQDCSQALKQSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JRA6	1.000	1.000	0.000	1907	1.000	1.000	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
2	AFDB:Q8BI84	0.148	0.146	0.000	1930	0.642	0.634	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
3	AFDB:Q96PC5	0.131	0.166	1.155E-32	1412	0.190	0.257	Q96PC5.pdb.gz	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4
4	AFDB:Q91ZV0	0.116	0.147	4.924E-27	1396	0.183	0.250	Q91ZV0.pdb.gz	MIA2_MOUSE Melanoma inhibitory activity protein 2 OS=Mus musculus OX=10090 GN=Mia2 PE=1 SV=3
5	AFDB:Q9VQM0	0.097	0.087	9.148E-12	2162	0.137	0.121	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
6	PDB:1k0xA	0.048	0.777	1.047E-8	108	0.020	0.352	1k0xA.pdb.gz
7	AFDB:P29617	0.033	0.036	1.436E-7	1703	0.122	0.136	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
8	AFDB:Q10925	0.052	0.074	3.818E-7	1237	0.064	0.099	Q10925.pdb.gz	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
9	AFDB:F4IZM8	0.044	0.056	1.297E-6	1347	0.086	0.122	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
10	AFDB:Q7SZL5	0.054	0.072	2.702E-6	1338	0.122	0.174	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
11	AFDB:Q5JR59	0.070	0.095	2.759E-5	1369	0.121	0.169	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
12	PDB:2dybA	0.032	0.194	4.279E-5	298	0.012	0.074	2dybA.pdb.gz
13	PDB:1griA	0.031	0.252	2.520E-4	211	0.008	0.076	1griA.pdb.gz
14	PDB:3qwyA	0.030	0.317	2.277E-3	170	0.005	0.059	3qwyA.pdb.gz
15	PDB:2eyzA	0.033	0.175	5.698E-3	304	0.010	0.062	2eyzA.pdb.gz
16	PDB:4mt6A	0.027	0.125	6.439E-3	389	0.008	0.039	4mt6A.pdb.gz
17	PDB:1k9aB	0.030	0.125	7.735E-3	441	0.005	0.023	1k9aB.pdb.gz
18	PDB:3ehqA	0.030	0.277	1.050E-2	182	0.005	0.055	3ehqA.pdb.gz
19	PDB:2h8hA	0.026	0.109	2.058E-2	445	0.007	0.029	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:2lqnA	0.029	0.166	2.969E-2	303	0.010	0.063	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRH6	0.0	1991	1015	0.521	0.979	A0A0A0MRH6_HUMAN MIA SH3 domain ER export factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=6
2	Q5JRA6	0.0	3919	1907	1.000	1.000	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
3	Q8BI84	0.0	2084	1930	0.647	0.639	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
4	Q96PC5	2.13e-62	238	1412	0.088	0.119	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4
5	G3V599	2.39e-62	238	1339	0.088	0.125	G3V599_HUMAN MIA SH3 domain ER export factor 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=1
6	Q91ZV0	1.45e-52	206	1396	0.083	0.113	MIA2_MOUSE Melanoma inhibitory activity protein 2 OS=Mus musculus OX=10090 GN=Mia2 PE=1 SV=3
7	Q9NRC9	3.44e-21	93.2	128	0.024	0.359	OTOR_HUMAN Otoraplin OS=Homo sapiens OX=9606 GN=OTOR PE=1 SV=1
8	Q9JIE3	1.07e-17	83.2	128	0.022	0.328	OTOR_MOUSE Otoraplin OS=Mus musculus OX=10090 GN=Otor PE=2 SV=1
9	Q16674	6.16e-14	72.8	131	0.019	0.275	MIA_HUMAN Melanoma-derived growth regulatory protein OS=Homo sapiens OX=9606 GN=MIA PE=1 SV=1
10	Q9VMA7	2.05e-13	78.6	1430	0.057	0.076	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
11	Q61865	3.60e-13	70.5	130	0.018	0.269	MIA_MOUSE Melanoma-derived growth regulatory protein OS=Mus musculus OX=10090 GN=Mia PE=2 SV=2
12	Q9BXG8	3.01e-12	73.2	430	0.027	0.121	SPZ1_HUMAN Spermatogenic leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=SPZ1 PE=1 SV=2
13	Q99MY0	5.78e-07	56.2	378	0.023	0.114	SPZ1_MOUSE Spermatogenic leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Spz1 PE=1 SV=1
14	Q9P219	2.68e-04	48.5	2028	0.047	0.044	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
15	Q5RHB5	0.001	46.2	1447	0.020	0.027	IRAG2_DANRE Inositol 1,4,5-triphosphate receptor associated 2 OS=Danio rerio OX=7955 GN=irag2 PE=1 SV=2
16	Q6P9Q6	0.004	44.7	1216	0.036	0.056	FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus OX=10090 GN=Fkbp15 PE=1 SV=2
17	Q8CGW9	0.039	40.8	370	0.032	0.165	DMRTD_MOUSE Doublesex- and mab-3-related transcription factor C2 OS=Mus musculus OX=10090 GN=Dmrtc2 PE=2 SV=1
18	A0A0R4INI3	0.065	40.8	1938	0.049	0.049	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
19	Q508P8	0.10	40.0	1938	0.049	0.048	Q508P8_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=im:6897999 PE=1 SV=1
20	F1QWN1	0.11	40.0	1063	0.040	0.072	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00018 SH3_1	45	15.1	SH3 domain
2	PF07653 SH3_2	5.2e-06	37.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306881	0.962	Protein transport protein Sec23A
2	9606.ENSP00000392495	0.962	Trafficking protein particle complex subunit 2
3	9606.ENSP00000332371	0.951	Collagen alpha-1(VII) chain
4	9606.ENSP00000379462	0.908	Endoplasmic reticulum export factor CTAGE5
5	9606.ENSP00000428564	0.905	Protein transport protein Sec24B
6	9606.ENSP00000434412	0.895	Serpin H1
7	9606.ENSP00000280082	0.880	Endoplasmic reticulum export factor CTAGE5
8	9606.ENSP00000260643	0.850	Prolactin regulatory element-binding protein
9	9606.ENSP00000325827	0.845	Protein transport protein Sec16A
10	9606.ENSP00000343405	0.823	Protein transport protein Sec24C
11	9606.ENSP00000343742	0.760	BRO1 domain-containing protein BROX
12	9606.ENSP00000381823	0.737	Protein transport protein Sec24A
13	9606.ENSP00000364883	0.687	Methylglutaconyl-CoA hydratase, mitochondrial
14	9606.ENSP00000280551	0.678	Protein transport protein Sec24D
15	9606.ENSP00000361001	0.675	EF-hand calcium-binding domain-containing protein 14
16	9606.ENSP00000251047	0.671	Protein ERGIC-53
17	9606.ENSP00000299238	0.671	Hermansky-Pudlak syndrome 6 protein
18	9606.ENSP00000356230	0.652	Kelch-like protein 12
19	9606.ENSP00000474388	0.647	CTAGE family member 6
20	9606.ENSP00000373312	0.632	Protein SEC13 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038024	1.000	cargo receptor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.985	biological regulation
GO:0051179	0.978	localization
GO:0050794	0.977	regulation of cellular process
GO:0071840	0.973	cellular component organization or biogenesis
GO:0051641	0.969	cellular localization
GO:0048518	0.960	positive regulation of biological process
GO:0016043	0.959	cellular component organization
GO:0032501	0.952	multicellular organismal process
GO:0048193	0.925	Golgi vesicle transport
GO:0046907	0.916	intracellular transport
GO:0006996	0.905	organelle organization
GO:0048856	0.891	anatomical structure development
GO:0007275	0.867	multicellular organism development
GO:0050896	0.864	response to stimulus
GO:0006888	0.862	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0016050	0.816	vesicle organization
GO:0006900	0.809	vesicle budding from membrane
GO:0048731	0.748	system development
GO:0048522	0.660	positive regulation of cellular process
GO:0051716	0.651	cellular response to stimulus
GO:0048523	0.646	negative regulation of cellular process
GO:0042221	0.542	response to chemical
GO:0033036	0.455	macromolecule localization
GO:0070727	0.418	cellular macromolecule localization
GO:0008104	0.412	protein localization
GO:0006950	0.382	response to stress
GO:0071702	0.369	organic substance transport
GO:0010033	0.359	response to organic substance
GO:0010256	0.351	endomembrane system organization
GO:0009653	0.342	anatomical structure morphogenesis
GO:0071705	0.329	nitrogen compound transport
GO:0090114	0.322	COPII-coated vesicle budding
GO:0090110	0.306	COPII-coated vesicle cargo loading

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0070013	0.994	intracellular organelle lumen
GO:0070971	0.647	endoplasmic reticulum exit site
GO:0005788	0.612	endoplasmic reticulum lumen
GO:0031981	0.413	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]