StarFunc result for job id Q5JRX3

User Input

>input (1037 residues)
MWRCGGRQGLCVLRRLSGGHAHHRAWRWNSNRACERALQYKLGDKIHGFTVNQVTSVPEL
FLTAVKLTHDDTGARYLHLAREDTNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCR
DPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQE
GWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQNRLLPDHTYSVVSGGDPL
CIPELTWEQLKQFHATHYHPSNARFFTYGNFPLEQHLKQIHEEALSKFQKIEPSTVVPAQ
TPWDKPREFQITCGPDSFATDPSKQTTISVSFLLPDITDTFEAFTLSLLSSLLTSGPNSP
FYKALIESGLGTDFSPDVGYNGYTREAYFSVGLQGIAEKDIETVRSLIDRTIDEVVEKGF
EDDRIEALLHKIEIQMKHQSTSFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQE
NPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEK
GLELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRA
FSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMD
TYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHL
YASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRC
SVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIR
KLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIR
EKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVF
STVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAI
LGPENPKIAKDPSWIIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4rpuA	0.950	0.997	0.000	988	0.948	0.995	4rpuA.pdb.gz	Crystal Structure of Human Presequence Protease in Complex with Inhibitor MitoBloCK-60
2	PDB:6xovA	0.926	0.994	0.000	966	0.928	0.996	6xovA.pdb.gz	Structural basis for the mechanisms of human presequence protease conformational switch and substrate recognition.
3	AFDB:Q5JRX3	1.000	1.000	0.000	1037	1.000	1.000	Q5JRX3.pdb.gz	PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1 PE=1 SV=3
4	AFDB:Q8K411	0.972	0.973	0.000	1036	0.865	0.866	Q8K411.pdb.gz	PREP_MOUSE Presequence protease, mitochondrial OS=Mus musculus OX=10090 GN=Pitrm1 PE=1 SV=1
5	AFDB:Q5B6H7	0.907	0.897	8.803E-93	1049	0.352	0.348	Q5B6H7.pdb.gz	PREP_EMENI Presequence protease, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cym1 PE=3 SV=1
6	AFDB:P32898	0.891	0.934	2.049E-92	989	0.339	0.356	P32898.pdb.gz	PREP_YEAST Presequence protease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYM1 PE=1 SV=2
7	AFDB:O42908	0.787	0.923	2.907E-84	882	0.325	0.382	O42908.pdb.gz	PREP_SCHPO Presequence protease, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cym1 PE=3 SV=1
8	AFDB:Q9LJL3	0.871	0.837	1.012E-77	1080	0.293	0.281	Q9LJL3.pdb.gz	PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PREP1 PE=1 SV=2
9	AFDB:Q8VY06	0.863	0.829	9.188E-77	1080	0.290	0.279	Q8VY06.pdb.gz	PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PREP2 PE=1 SV=1
10	PDB:2fgeA	0.863	0.912	3.354E-76	979	0.282	0.298	2fgeA.pdb.gz	The closed structure of presequence protease PreP forms a unique 10 000 A(3) chamber for proteolysis
11	AFDB:A0A0L7KF24	0.848	0.741	1.279E-62	1193	0.227	0.197	A0A0L7KF24.pdb.gz	FCLN_PLAFX Falcilysin OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=FLN PE=1 SV=1
12	PDB:3s5mA	0.847	0.804	3.523E-62	1094	0.222	0.210	3s5mA.pdb.gz	Crystal structures of falcilysin, a M16 metalloprotease from the malaria parasite Plasmodium falciparum
13	PDB:7diaA	0.835	0.808	4.455E-62	1072	0.220	0.213	7diaA.pdb.gz	Protease in complex with inhibitor
14	AFDB:Q12496	0.799	0.799	1.956E-48	1037	0.163	0.163	Q12496.pdb.gz	YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOL098C PE=1 SV=1
15	AFDB:Q10068	0.794	0.795	1.471E-47	1036	0.174	0.174	Q10068.pdb.gz	YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H1.02c PE=4 SV=1
16	PDB:6ofsA	0.311	0.351	7.428E-31	905	0.143	0.164	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
17	PDB:1q2lA	0.385	0.419	1.502E-30	937	0.149	0.165	1q2lA.pdb.gz	Crystal Structure of pitrilysin, the prototype of insulin-degrading enzymes
18	PDB:2g49A	0.617	0.655	3.171E-29	970	0.131	0.140	2g49A.pdb.gz	Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.
19	PDB:4iofA	0.588	0.647	1.122E-27	932	0.134	0.149	4iofA.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
20	PDB:4iofB	0.548	0.644	2.039E-23	861	0.129	0.156	4iofB.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRX9	0.0	1730	832	0.802	1.000	A0A0A0MRX9_HUMAN Pitrilysin metalloproteinase 1 OS=Homo sapiens OX=9606 GN=PITRM1 PE=1 SV=2
2	A0A8H8UNX0	0.0	588	989	0.358	0.375	A0A8H8UNX0_YEASX Presequence protease, mitochondrial OS=Saccharomyces cerevisiae OX=4932 GN=CYM1 PE=3 SV=1
3	O42908	0.0	652	882	0.328	0.385	PREP_SCHPO Presequence protease, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cym1 PE=3 SV=1
4	P32898	0.0	588	989	0.358	0.375	PREP_YEAST Presequence protease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYM1 PE=1 SV=2
5	Q5B6H7	0.0	592	1049	0.356	0.352	PREP_EMENI Presequence protease, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cym1 PE=3 SV=1
6	Q5JRX3	0.0	2169	1037	1.000	1.000	PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1 PE=1 SV=3
7	Q8K411	0.0	1878	1036	0.866	0.867	PREP_MOUSE Presequence protease, mitochondrial OS=Mus musculus OX=10090 GN=Pitrm1 PE=1 SV=1
8	Q9LJL3	3.02e-132	429	1080	0.294	0.282	PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PREP1 PE=1 SV=2
9	Q8VY06	2.38e-129	421	1080	0.281	0.269	PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PREP2 PE=1 SV=1
10	Q76NL8	8.90e-52	201	1193	0.148	0.128	FCLN_PLAF7 Falcilysin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FLN PE=1 SV=1
11	A0A0L7KF24	9.22e-52	201	1193	0.148	0.128	FCLN_PLAFX Falcilysin OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=FLN PE=1 SV=1
12	Q12496	3.96e-19	95.9	1037	0.124	0.124	YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOL098C PE=1 SV=1
13	Q10068	4.84e-14	79.3	1036	0.077	0.077	YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H1.02c PE=4 SV=1
14	P40851	1.33e-05	52.0	1208	0.062	0.053	AXL1_YEAST Putative protease AXL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AXL1 PE=1 SV=2
15	Q9FJT9	5.28e-05	49.7	956	0.081	0.088	PQQL_ARATH Zinc protease PQQL-like OS=Arabidopsis thaliana OX=3702 GN=At5g56730 PE=1 SV=1
16	P31828	0.002	45.1	931	0.053	0.059	PQQL_ECOLI Probable zinc protease PqqL OS=Escherichia coli (strain K12) OX=83333 GN=pqqL PE=1 SV=2
17	Q40983	0.002	45.1	1257	0.061	0.050	SPP_PEA Stromal processing peptidase, chloroplastic OS=Pisum sativum OX=3888 GN=SPP PE=1 SV=2
18	O22941	0.003	44.3	970	0.052	0.056	IDE1_ARATH Insulin-degrading enzyme-like 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PXM16 PE=2 SV=1
19	P05458	0.003	44.3	962	0.079	0.085	PTRA_ECOLI Protease 3 OS=Escherichia coli (strain K12) OX=83333 GN=ptrA PE=1 SV=1
20	B8B0E2	0.007	42.7	1246	0.057	0.047	SPP_ORYSI Stromal processing peptidase, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=OsI_23765 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08367 M16C_assoc	3.4e-81	283.7	Peptidase M16C associated
2	PF00675 Peptidase_M16	3e-06	38.8	Insulinase (Peptidase family M16)
3	PF05193 Peptidase_M16_C	8.2e-34	128.8	Peptidase M16 inactive domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.978	Amyloid-beta A4 protein
2	9606.ENSP00000216027	0.945	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
3	9606.ENSP00000366482	0.920	Frataxin, mitochondrial
4	9606.ENSP00000377033	0.916	ATP synthase F(0) complex subunit C1, mitochondrial
5	9606.ENSP00000262030	0.913	ATP synthase subunit beta, mitochondrial
6	9606.ENSP00000373620	0.904	60 kDa heat shock protein, mitochondrial
7	9606.ENSP00000300051	0.903	Probable D-lactate dehydrogenase, mitochondrial
8	9606.ENSP00000310873	0.902	4-hydroxybenzoate polyprenyltransferase, mitochondrial
9	9606.ENSP00000299166	0.901	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
10	9606.ENSP00000039007	0.900	Ornithine carbamoyltransferase, mitochondrial
11	9606.ENSP00000356919	0.809	Cyclic AMP-dependent transcription factor ATF-6 alpha
12	9606.ENSP00000362824	0.808	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
13	9606.ENSP00000300648	0.768	eIF-2-alpha kinase activator GCN1
14	9606.ENSP00000297338	0.740	Double-strand-break repair protein rad21 homolog
15	9606.ENSP00000342026	0.672	Peroxiredoxin-6
16	9606.ENSP00000265986	0.671	Insulin-degrading enzyme
17	9606.ENSP00000370372	0.669	Neurolysin, mitochondrial
18	9606.ENSP00000355759	0.654	Poly [ADP-ribose] polymerase 1
19	9606.ENSP00000355621	0.645	Tetratricopeptide repeat domain containing
20	9606.ENSP00000419325	0.633	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008047	1.000	enzyme activator activity
GO:0008270	1.000	zinc ion binding
GO:0004222	1.000	metalloendopeptidase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0006508	0.988	proteolysis
GO:0016043	0.969	cellular component organization
GO:0006839	0.943	mitochondrial transport
GO:0070585	0.942	protein localization to mitochondrion
GO:0006996	0.922	organelle organization
GO:0007005	0.908	mitochondrion organization
GO:0006886	0.898	intracellular protein transport
GO:0006605	0.855	protein targeting
GO:0072594	0.829	establishment of protein localization to organelle
GO:0006626	0.806	protein targeting to mitochondrion
GO:0044237	0.300	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.747	mitochondrial matrix
GO:0016020	0.529	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]