StarFunc result for job id Q5JS13

User Input

>input (557 residues)
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESPTGP
CICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDR
KHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDD
ACKSNRPQVPANLMSFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JS13	1.000	1.000	1.983E-82	557	1.000	1.000	Q5JS13.pdb.gz	RGPS1_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Homo sapiens OX=9606 GN=RALGPS1 PE=1 SV=1
2	AFDB:Q86X27	0.545	0.522	9.485E-56	583	0.637	0.609	Q86X27.pdb.gz	RGPS2_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1
3	AFDB:Q0E949	0.491	0.393	1.369E-37	702	0.400	0.318	Q0E949.pdb.gz	Q0E949_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=RalGPS PE=4 SV=1
4	AFDB:Q9U4U5	0.412	0.247	5.067E-14	954	0.208	0.122	Q9U4U5.pdb.gz	Q9U4U5_DROME LD16082p OS=Drosophila melanogaster OX=7227 GN=Rgl PE=2 SV=1
5	AFDB:Q9N5D3	0.409	0.156	1.970E-13	1493	0.176	0.066	Q9N5D3.pdb.gz	SOS_CAEEL Son of sevenless homolog OS=Caenorhabditis elegans OX=6239 GN=sos-1 PE=1 SV=3
6	AFDB:P26675	0.420	0.150	1.954E-12	1596	0.165	0.058	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
7	AFDB:Q54S40	0.383	0.169	1.954E-12	1312	0.203	0.086	Q54S40.pdb.gz	GBPD_DICDI Cyclic GMP-binding protein D OS=Dictyostelium discoideum OX=44689 GN=gbpD PE=2 SV=1
8	AFDB:F1R019	0.415	0.176	3.763E-12	1341	0.160	0.066	F1R019.pdb.gz	F1R019_DANRE Son of sevenless homolog 2 OS=Danio rerio OX=7955 GN=si:ch211-67f24.8 PE=1 SV=2
9	AFDB:P0CF34	0.392	0.213	4.984E-12	1048	0.145	0.077	P0CF34.pdb.gz	YL016_YEAST Putative truncated guanine nucleotide exchange factor SDC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDC25 PE=5 SV=1
10	AFDB:F1MAI3	0.415	0.177	5.223E-12	1333	0.153	0.064	F1MAI3.pdb.gz	F1MAI3_RAT SOS Ras/Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Sos2 PE=4 SV=1
11	PDB:2byvE	0.402	0.247	1.957E-9	922	0.104	0.063	2byvE.pdb.gz
12	PDB:4f7zA	0.384	0.230	5.482E-9	946	0.102	0.060	4f7zA.pdb.gz
13	PDB:6bbpA	0.157	0.167	8.471E-5	520	0.090	0.096	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:3ljuX	0.148	0.212	1.281E-3	373	0.034	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:6u3eA	0.164	0.218	1.342E-3	397	0.090	0.126	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:4mt6A	0.185	0.253	3.117E-3	389	0.079	0.113	4mt6A.pdb.gz
17	PDB:7rx9A	0.161	0.202	4.751E-3	432	0.083	0.106	7rx9A.pdb.gz
18	PDB:7c3mA	0.164	0.159	4.979E-3	577	0.045	0.043	7c3mA.pdb.gz
19	PDB:3m1iB	0.145	0.493	6.594E-3	131	0.016	0.069	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
20	PDB:6hhgA	0.142	0.200	7.952E-3	386	0.027	0.039	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JS13	0.0	1151	557	1.000	1.000	RGPS1_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS1 OS=Homo sapiens OX=9606 GN=RALGPS1 PE=1 SV=1
2	Q86X27	0.0	686	583	0.630	0.602	RGPS2_HUMAN Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1
3	Q0E949	3.46e-126	387	702	0.434	0.345	Q0E949_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=RalGPS PE=4 SV=1
4	Q8IS18	5.71e-30	127	1037	0.120	0.065	GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum OX=44689 GN=gefE PE=2 SV=1
5	Q3UYI5	8.15e-30	126	709	0.153	0.120	RGL3_MOUSE Ral guanine nucleotide dissociation stimulator-like 3 OS=Mus musculus OX=10090 GN=Rgl3 PE=1 SV=2
6	P28818	9.46e-30	127	1244	0.144	0.064	RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus OX=10116 GN=Rasgrf1 PE=1 SV=1
7	Q03385	1.86e-28	122	852	0.153	0.100	GNDS_MOUSE Ral guanine nucleotide dissociation stimulator OS=Mus musculus OX=10090 GN=Ralgds PE=1 SV=2
8	P27671	2.64e-28	122	1262	0.138	0.061	RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus OX=10090 GN=Rasgrf1 PE=1 SV=2
9	Q54PQ4	5.46e-28	120	605	0.108	0.099	GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum OX=44689 GN=gefA PE=1 SV=1
10	Q03386	6.49e-28	121	895	0.153	0.095	GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus OX=10116 GN=Ralgds PE=1 SV=1
11	A0A2X0SFL3	9.26e-28	120	1237	0.140	0.063	A0A2X0SFL3_HUMAN RASGRF2 (Fragment) OS=Homo sapiens OX=9606 GN=RASGRF2 PE=4 SV=1
12	O14827	9.26e-28	120	1237	0.140	0.063	RGRF2_HUMAN Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens OX=9606 GN=RASGRF2 PE=1 SV=2
13	Q8SSQ0	1.11e-27	120	1721	0.138	0.045	GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum OX=44689 GN=gefR PE=1 SV=1
14	Q13972	1.24e-27	120	1273	0.136	0.060	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
15	B0M0P8	1.73e-27	120	2356	0.136	0.032	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
16	P70392	2.07e-27	119	1189	0.135	0.063	RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus OX=10090 GN=Rasgrf2 PE=1 SV=2
17	Q99JE4	6.94e-27	118	1190	0.133	0.062	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1
18	Q9USU1	1.91e-26	116	987	0.135	0.076	EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=efc25 PE=1 SV=1
19	P04821	2.17e-26	117	1589	0.140	0.049	CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC25 PE=1 SV=1
20	Q12967	2.56e-26	116	914	0.151	0.092	GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens OX=9606 GN=RALGDS PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	6e-08	44.5	PH domain
2	PF00617 RasGEF	6.7e-50	181.3	RasGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000399415	0.718	Kynurenine--oxoglutarate transaminase 1
2	9606.ENSP00000264170	0.680	Kynureninase
3	9606.ENSP00000370208	0.670	RAB guanine nucleotide exchange factor 1
4	9606.ENSP00000005257	0.651	Ras-related protein Ral-A
5	9606.ENSP00000322181	0.640	Dolichol phosphate-mannose biosynthesis regulatory protein
6	9606.ENSP00000386722	0.639	FCH and double SH3 domains 2
7	9606.ENSP00000362727	0.628	DENN domain-containing protein 1A
8	9606.ENSP00000427888	0.617	Heparan sulfate glucosamine 3-O-sulfotransferase 5
9	9606.ENSP00000362485	0.584	GTPase-activating Rap/Ran-GAP domain-like protein 3
10	9606.ENSP00000335255	0.545	Angiopoietin-related protein 5
11	9606.ENSP00000272519	0.542	Ras-related protein Ral-B
12	9606.ENSP00000366015	0.541	Angiopoietin-related protein 7
13	9606.ENSP00000234816	0.535	Angiopoietin-related protein 1
14	9606.ENSP00000361397	0.530	NUT family member 2G
15	9606.ENSP00000362751	0.523	Rab GTPase-activating protein 1
16	9606.ENSP00000378307	0.516	Protein polybromo-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0051056	0.951	regulation of small GTPase mediated signal transduction
GO:0009987	0.771	cellular process
GO:0046578	0.765	regulation of Ras protein signal transduction
GO:0050896	0.487	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.992	cytosol
GO:0016020	0.938	membrane
GO:0005886	0.934	plasma membrane
GO:0043227	0.866	membrane-bounded organelle
GO:0043229	0.799	intracellular organelle
GO:0043231	0.776	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]